HMGB1 protein

Recombinant Human High-Mobility Group Box 1(His6-tagged) (rHu HMGB1)

Cat. Num. AAA546104

• Gene Names: HMGB1; HMG1; HMG3; SBP-1
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Synonyms: HMGB1; Recombinant Human High-Mobility Group Box 1(His6-tagged) (rHu HMGB1); human HMGB1; Human High-Mobility Group Box 1; HMGB1 protein

• Host: E Coli
• Purity/Purification: >95% by SDS-PAGE and HPLC analyses.
• Form/Format: Lyophilized from a 0.2mm filtered concentrated (1mg/ml) solution in PBS, pH 7.4.; Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFED MAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFC5EYRPKIKGEHPGLSIGDVAKK LGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK5KKKKEEEEDEE D EEDEE EEED EEDED E EEDD DDELEH H H H H H
• Sequence Length: 215

• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < = -20 degree C. Further dilutions should be made in appropriate buffered solutions.
• Endotoxin Level: Less than 1EU/mg of rHuHMGB1 as determined by LAL method.
• Preparation and Storage: This lyophilized preparation is stable at 2-8 degree C, but should be kept at -20 degree C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2 8 degree C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 degree C to -70 degree C. Avoid repeated freeze/thaw cycles.

Related Product Information for HMGB1 protein

Human High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 - 43 and 178 - 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins.

NCBI and Uniprot Product Information

• NCBI GI #: 4504425
• NCBI GeneID: 3146
• NCBI Accession #: NP_002119.1
• NCBI GenBank Nucleotide #: NM_002128.4
• UniProt Accession #: P09429; Q14321; Q5T7C3; Q6IBE1; A5D8W9
• Molecular Weight: Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 233 amino acids.
• NCBI Official Full Name: high mobility group protein B1
• NCBI Official Synonym Full Names: high mobility group box 1
• NCBI Official Symbol: HMGB1
• NCBI Official Synonym Symbols: HMG1; HMG3; SBP-1
• NCBI Protein Information: high mobility group protein B1; HMG-1; Amphoterin; high-mobility group box 1; high mobility group protein 1; Sulfoglucuronyl carbohydrate binding protein; high-mobility group (nonhistone chromosomal) protein 1
• UniProt Protein Name: High mobility group protein B1
• Protein Family: High mobility group protein
• UniProt Gene Name: HMGB1
• UniProt Synonym Gene Names: HMG1; HMG-1
• UniProt Entry Name: HMGB1_HUMAN

Uniprot Description

HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family.

Protein type: DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: nucleoplasm; extracellular space; cell surface; transcriptional repressor complex; extracellular region; condensed chromosome; nucleus

Molecular Function: protein binding; RAGE receptor binding; double-stranded DNA binding; cytokine activity; damaged DNA binding; chromatin binding; transcription factor binding; transcription factor activity; DNA bending activity; single-stranded DNA binding; chemoattractant activity

Biological Process: negative regulation of transcriptional preinitiation complex assembly; DNA topological change; V(D)J recombination; positive regulation of apoptosis; apoptosis; positive regulation of caspase activity; base-excision repair, DNA ligation; negative regulation of transcription from RNA polymerase II promoter; DNA recombination; regulation of transcription from RNA polymerase II promoter; chromatin remodeling; myeloid dendritic cell activation; inflammatory response to antigenic stimulus; positive chemotaxis; dendritic cell chemotaxis; DNA ligation during DNA repair; innate immune response; positive regulation of transcription from RNA polymerase II promoter; DNA fragmentation during apoptosis; neurite development; cell structure disassembly during apoptosis; positive regulation of DNA binding