Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GPR56 antibody (MBS5303193) used at 1 ug/ml to detect target protein.)

Rabbit GPR56 Polyclonal Antibody | anti-GPR56 antibody

GPR56 antibody

Gene Names
ADGRG1; BFPP; BPPR; GPR56; TM7LN4; TM7XN1
Applications
Western Blot
Purity
Affinity purified
Synonyms
GPR56; Polyclonal Antibody; GPR56 antibody; Polyclonal GPR56; Anti-GPR56; GPR-56; GPR 56; DKFZp781L1398; TM7XN1; G Protein-Coupled Receptor 56; TM7LN4; BFPP; anti-GPR56 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
GPR56 antibody was raised against the N terminal of GPR56
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR56 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
512
Applicable Applications for anti-GPR56 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
GPR56 could be involved in cell-cell interactions.
Cross-Reactivity
Human
Immunogen
GPR56 antibody was raised using the N terminal of GPR56 corresponding to a region with amino acids MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(GPR56 antibody (MBS5303193) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (GPR56 antibody (MBS5303193) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-GPR56 antibody
Rabbit polyclonal GPR56 antibody raised against the N terminal of GPR56
Product Categories/Family for anti-GPR56 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
76 kDa (MW of target protein)
NCBI Official Full Name
G-protein coupled receptor 56 isoform f
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor G1
NCBI Official Symbol
ADGRG1
NCBI Official Synonym Symbols
BFPP; BPPR; GPR56; TM7LN4; TM7XN1
NCBI Protein Information
G-protein coupled receptor 56
UniProt Protein Name
G-protein coupled receptor 56
UniProt Gene Name
GPR56
UniProt Synonym Gene Names
TM7LN4; TM7XN1; GPR56 NT; GPR56(N); GPR56 CT; GPR56(C); GPR56 7TM
UniProt Entry Name
GPR56_HUMAN

NCBI Description

This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

GPR56: Could be involved in cell-cell interactions. Defects in GPR56 are the cause of bilateral frontoparietal polymicrogyria (BFPP). BFPP is characterized by disorganized cortical lamination that is most severe in frontal cortex. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; Cell adhesion; GPCR, family 2; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: integral to plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; collagen binding; extracellular matrix binding

Biological Process: negative regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; positive regulation of cell adhesion; cell-cell signaling; cerebral cortex radial glia guided migration; positive regulation of Rho protein signal transduction; brain development; angiogenesis; cell adhesion; Rho protein signal transduction; layer formation in the cerebral cortex

Disease: Polymicrogyria, Bilateral Frontoparietal; Polymicrogyria, Bilateral Perisylvian, Autosomal Recessive

Research Articles on GPR56

Similar Products

Product Notes

The GPR56 gpr56 (Catalog #AAA5303193) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GPR56 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the GPR56 gpr56 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR56, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.