Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human PCDHA10 Monoclonal Antibody | anti-PCDHA10 antibody

PCDHA10 (Protocadherin alpha-10, PCDH-alpha-10, CNRS8, CNR8, CNRN8, CRNR8)

Gene Names
PCDHA10; CNR8; CNRN8; CNRS8; CRNR8; PCDH-ALPHA10
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PCDHA10; Monoclonal Antibody; PCDHA10 (Protocadherin alpha-10; PCDH-alpha-10; CNRS8; CNR8; CNRN8; CRNR8); Anti -PCDHA10 (Protocadherin alpha-10; anti-PCDHA10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F6
Specificity
Recognizes human PCDHA10.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
INKKDKDKFPVLVLRKLLDREENPQLKLLLTATDGGKPEFTGSVSLLILVLDANDNAPIFDRPVYEVKMYENQVNQTLVIRLNASDSDEGINKEMMYSFSSLVPPTIRR
Applicable Applications for anti-PCDHA10 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa182-291 from human PCDHA10 (NP_061724) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PCDHA10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PCDHA10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)
Related Product Information for anti-PCDHA10 antibody
This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. [provided by RefSeq]
Product Categories/Family for anti-PCDHA10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102,875 Da
NCBI Official Full Name
protocadherin alpha-10 isoform 3
NCBI Official Synonym Full Names
protocadherin alpha 10
NCBI Official Symbol
PCDHA10
NCBI Official Synonym Symbols
CNR8; CNRN8; CNRS8; CRNR8; PCDH-ALPHA10
NCBI Protein Information
protocadherin alpha-10; PCDH-alpha-10; KIAA0345-like 4; ortholog to mouse CNR8
UniProt Protein Name
Protocadherin alpha-10
Protein Family
UniProt Gene Name
PCDHA10
UniProt Synonym Gene Names
CNRS8; PCDH-alpha-10
UniProt Entry Name
PCDAA_HUMAN

NCBI Description

This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PCDHA10: Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: integral to plasma membrane; extracellular region

Molecular Function: calcium ion binding

Biological Process: nervous system development; homophilic cell adhesion; cell adhesion

Similar Products

Product Notes

The PCDHA10 pcdha10 (Catalog #AAA6011127) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCDHA10 (Protocadherin alpha-10, PCDH-alpha-10, CNRS8, CNR8, CNRN8, CRNR8) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCDHA10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the PCDHA10 pcdha10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: INKKDKDKFP VLVLRKLLDR EENPQLKLLL TATDGGKPEF TGSVSLLILV LDANDNAPIF DRPVYEVKMY ENQVNQTLVI RLNASDSDEG INKEMMYSFS SLVPPTIRR. It is sometimes possible for the material contained within the vial of "PCDHA10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.