Western Blot (WB)
(CCDC78 antibody (MBS5301796) used at 1 ug/ml to detect target protein.)
Rabbit CCDC78 Polyclonal Antibody | anti-CCDC78 antibody
CCDC78 antibody
Gene Names
CCDC78; CNM4; JFP10; C16orf25; hsCCDC78
Applications
Western Blot
Purity
Affinity purified
Synonyms
CCDC78; Polyclonal Antibody; CCDC78 antibody; Polyclonal CCDC78; Anti-CCDC78; Coiled-Coil Domain Containing 78; CCDC 78; CCDC-78; C16orf25; JFP10; FLJ34512; anti-CCDC78 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
CCDC78 antibody was raised against the middle region of CCDC78
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC78 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
438
Applicable Applications for anti-CCDC78 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of CCDC78 protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human
Immunogen
CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(CCDC78 antibody (MBS5301796) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(CCDC78 antibody (MBS5301796) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CCDC78 antibody
Rabbit polyclonal CCDC78 antibody raised against the middle region of CCDC78
Product Categories/Family for anti-CCDC78 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37 kDa (MW of target protein)
NCBI Official Full Name
coiled-coil domain-containing protein 78
NCBI Official Synonym Full Names
coiled-coil domain containing 78
NCBI Official Symbol
CCDC78
NCBI Official Synonym Symbols
CNM4; JFP10; C16orf25; hsCCDC78
NCBI Protein Information
coiled-coil domain-containing protein 78
UniProt Protein Name
Coiled-coil domain-containing protein 78
Protein Family
UniProt Gene Name
CCDC78
UniProt Synonym Gene Names
C16orf25
UniProt Entry Name
CCD78_HUMAN
NCBI Description
The product of this gene contains two coiled-coil domains. The function of this gene is currently unknown. [provided by RefSeq, Sep 2012]
Uniprot Description
GM938: The product of this gene contains two coiled-coil domains. The function of this gene is currently unknown. [provided by RefSeq, Sep 2012]
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: centriole; sarcoplasmic reticulum; perinuclear region of cytoplasm; sarcolemma
Biological Process: skeletal muscle contraction; cell projection organization and biogenesis
Disease: Myopathy, Centronuclear, 4
Research Articles on CCDC78
Similar Products
Product Notes
The CCDC78 ccdc78 (Catalog #AAA5301796) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CCDC78 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CCDC78 ccdc78 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCDC78, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
