Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit SERPINB4 Polyclonal Antibody | anti-SERPINB4 antibody

SERPINB4 antibody

Gene Names
SERPINB4; PI11; SCCA1; SCCA2; LEUPIN; SCCA-2
Applications
Western Blot
Purity
Affinity purified
Synonyms
SERPINB4; Polyclonal Antibody; SERPINB4 antibody; Polyclonal SERPINB4; Anti-SERPINB4; SERPINB-4; PI11; LEUPIN; Serpin Peptidase Inhibitor Clade B Member 4; SCCA2; SERPINB 4; Ovalbumin 4; SCCA1; SCCA-2; anti-SERPINB4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINB4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
369
Applicable Applications for anti-SERPINB4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SERPINB4 may act as a protease inhibitor to modulate the host immune response against tumor cells.
Cross-Reactivity
Human
Immunogen
SERPINB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SERPINB4 antibody
Rabbit polyclonal SERPINB4 antibody
Product Categories/Family for anti-SERPINB4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45 kDa (MW of target protein)
NCBI Official Full Name
serpin B4 isoform 2
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade B (ovalbumin), member 4
NCBI Official Symbol
SERPINB4
NCBI Official Synonym Symbols
PI11; SCCA1; SCCA2; LEUPIN; SCCA-2
NCBI Protein Information
serpin B4
UniProt Protein Name
Serpin B4
Protein Family
UniProt Gene Name
SERPINB4
UniProt Synonym Gene Names
PI11; SCCA2; PI-11; SCCA-2
UniProt Entry Name
SPB4_HUMAN

Uniprot Description

SERPINB4: May act as a protease inhibitor to modulate the host immune response against tumor cells. Belongs to the serpin family. Ov-serpin subfamily.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 18q21.3

Cellular Component: extracellular space; cytoplasm; intracellular

Molecular Function: serine-type endopeptidase inhibitor activity; enzyme binding; protease binding

Biological Process: regulation of proteolysis; negative regulation of peptidase activity; protection from natural killer cell mediated cytotoxicity

Research Articles on SERPINB4

Similar Products

Product Notes

The SERPINB4 serpinb4 (Catalog #AAA5301629) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SERPINB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SERPINB4 serpinb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.