Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C19ORF62 antibody (MBS5300959) used at 1 ug/ml to detect target protein.)

Rabbit C19ORF62 Polyclonal Antibody | anti-C19ORF62 antibody

C19ORF62 antibody

Gene Names
BABAM1; NBA1; HSPC142; MERIT40; C19orf62
Applications
Western Blot
Purity
Affinity purified
Synonyms
C19ORF62; Polyclonal Antibody; C19ORF62 antibody; Polyclonal C19ORF62; Anti-C19ORF62; HSPC142; FLJ20571; Chromosome ORF 19; Chromosome 19 ORF; Chromosome ORF-19; anti-C19ORF62 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C19ORF62 antibody was raised against the N terminal Of C19Orf62
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF62 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
329
Applicable Applications for anti-C19ORF62 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).
Cross-Reactivity
Human
Immunogen
C19ORF62 antibody was raised using the N terminal Of C19Orf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C19ORF62 antibody (MBS5300959) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C19ORF62 antibody (MBS5300959) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C19ORF62 antibody
Rabbit polyclonal C19ORF62 antibody raised against the N terminal Of C19Orf62
Product Categories/Family for anti-C19ORF62 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
Chromosome 19 open reading frame 62
NCBI Official Synonym Full Names
BRISC and BRCA1 A complex member 1
NCBI Official Symbol
BABAM1
NCBI Official Synonym Symbols
NBA1; HSPC142; MERIT40; C19orf62
NCBI Protein Information
BRISC and BRCA1-A complex member 1
UniProt Protein Name
BRISC and BRCA1-A complex member 1
UniProt Gene Name
BABAM1
UniProt Synonym Gene Names
C19orf62; MERIT40; NBA1
UniProt Entry Name
BABA1_HUMAN

Uniprot Description

NBA1: a component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it is required for the complex integrity and its localization at DSBs. Probably also plays a role as a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. In these 2 complexes, it is probably required to maintain the stability of BRE/BRCC45 and help the 'Lys-63'-linked deubiquitinase activity mediated by BRCC3/BRCC36 component. The VWFA-like region is similar to the VWFA domain. Its presence reveals similarities between the structure of the 19S proteasome and the BRCA1-A complexes. Two alternatively spliced human isoforms have been reported.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: positive regulation of DNA repair; double-strand break repair; chromatin modification; response to ionizing radiation; G2/M transition DNA damage checkpoint

Research Articles on C19ORF62

Similar Products

Product Notes

The C19ORF62 babam1 (Catalog #AAA5300959) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C19ORF62 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C19ORF62 babam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C19ORF62, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.