Western Blot (WB)
(Ubiquilin 3 antibody (MBS5300512) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Mouse Ubiquilin 3 Polyclonal Antibody | anti-UBQLN3 antibody
Ubiquilin 3 antibody
Gene Names
UBQLN3; TUP-1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
Ubiquilin 3; Polyclonal Antibody; Ubiquilin 3 antibody; Polyclonal Ubiquilin 3; Anti-Ubiquilin 3; Ubiquilin -3; TUP-1; UBQLN3; anti-UBQLN3 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
Ubiquilin 3 antibody was raised against the N terminal of UBQLN3
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBQLN3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
655
Applicable Applications for anti-UBQLN3 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.
Cross-Reactivity
Human,Mouse
Immunogen
Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Ubiquilin 3 antibody (MBS5300512) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(Ubiquilin 3 antibody (MBS5300512) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-UBQLN3 antibody
Rabbit polyclonal Ubiquilin 3 antibody raised against the N terminal of UBQLN3
Product Categories/Family for anti-UBQLN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
72 kDa (MW of target protein)
NCBI Official Full Name
ubiquilin-3
NCBI Official Synonym Full Names
ubiquilin 3
NCBI Official Symbol
UBQLN3
NCBI Official Synonym Symbols
TUP-1
NCBI Protein Information
ubiquilin-3
UniProt Protein Name
Ubiquilin-3
Protein Family
UniProt Gene Name
UBQLN3
UniProt Entry Name
UBQL3_HUMAN
NCBI Description
Summary: This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This gene is specifically expressed in the testis, and proposed to regulate cell-cycle progression during spermatogenesis. [provided by RefSeq, Jul 2008]
Uniprot Description
UBQLN3:
Chromosomal Location of Human Ortholog: 11p15
Research Articles on UBQLN3
Similar Products
Product Notes
The UBQLN3 ubqln3 (Catalog #AAA5300512) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ubiquilin 3 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Ubiquilin 3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the UBQLN3 ubqln3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ubiquilin 3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
