Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit HNRPC Polyclonal Antibody | anti-HNRPC antibody

HNRPC antibody

Gene Names
HNRNPC; C1; C2; HNRNP; HNRPC; SNRPC
Applications
Western Blot
Purity
Affinity purified
Synonyms
HNRPC; Polyclonal Antibody; HNRPC antibody; Polyclonal HNRPC; Anti-HNRPC; C2; HNRNP; hnRNPC; MGC104306; C1/C2; MGC105117; Heterogeneous Nuclear Ribonucleoprotein C; MGC131677; C1; MGC117353; SNRPC; anti-HNRPC antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPC antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
102
Applicable Applications for anti-HNRPC antibody
Western Blot (WB)
Application Notes
WB: 0.25 ug/ml
Biological Significance
HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.
Cross-Reactivity
Human
Immunogen
HNRPC antibody was raised using a synthetic peptide corresponding to a region with amino acids LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-HNRPC antibody
Rabbit polyclonal HNRPC antibody
Product Categories/Family for anti-HNRPC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
HNRPC protein
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein C (C1/C2)
NCBI Official Symbol
HNRNPC
NCBI Official Synonym Symbols
C1; C2; HNRNP; HNRPC; SNRPC
NCBI Protein Information
heterogeneous nuclear ribonucleoproteins C1/C2
UniProt Protein Name
Heterogeneous nuclear ribonucleoproteins C1/C2
UniProt Gene Name
HNRNPC
UniProt Synonym Gene Names
HNRPC; hnRNP C1/C2
UniProt Entry Name
HNRPC_HUMAN

NCBI Description

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP C1/C2: a heterogeneous nuclear ribonucleoprotein. May play a role in ribonucleosome assembly by neutralizing basic proteins such as A and B core hnRNP. Contains 1 RNA recognition motif (RRM) domain. Two alternatively spliced isoforms have been described.

Protein type: Spliceosome; RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: nucleoplasm; spliceosome; protein complex; membrane; nuclear chromatin; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; nucleosomal DNA binding; mRNA 3'-UTR binding; RNA binding; nucleotide binding; poly(U) binding

Biological Process: osteoblast differentiation; nuclear mRNA splicing, via spliceosome; RNA splicing; ATP-dependent chromatin remodeling; gene expression

Research Articles on HNRPC

Similar Products

Product Notes

The HNRPC hnrnpc (Catalog #AAA5300357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRPC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.25 ug/ml. Researchers should empirically determine the suitability of the HNRPC hnrnpc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.