Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Claudin 19 antibody (MBS5300212) used at 1 ug/ml to detect target protein.)

Rabbit Claudin 19 Polyclonal Antibody | anti-CLDN19 antibody

Claudin 19 antibody

Gene Names
CLDN19; HOMG5
Applications
Western Blot
Purity
Affinity purified
Synonyms
Claudin 19; Polyclonal Antibody; Claudin 19 antibody; Polyclonal Claudin 19; Anti-Claudin 19; Claudin -19; CLDN19; anti-CLDN19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Claudin 19 antibody was raised against the C terminal of CLDN19
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN19 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
211
Applicable Applications for anti-CLDN19 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CLDN19 belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO).
Cross-Reactivity
Human
Immunogen
Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Claudin 19 antibody (MBS5300212) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Claudin 19 antibody (MBS5300212) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CLDN19 antibody
Rabbit polyclonal Claudin 19 antibody raised against the C terminal of CLDN19
Product Categories/Family for anti-CLDN19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23 kDa (MW of target protein)
NCBI Official Full Name
claudin-19 isoform b
NCBI Official Synonym Full Names
claudin 19
NCBI Official Symbol
CLDN19
NCBI Official Synonym Symbols
HOMG5
NCBI Protein Information
claudin-19
UniProt Protein Name
Claudin-19
Protein Family
UniProt Gene Name
CLDN19
UniProt Entry Name
CLD19_HUMAN

NCBI Description

The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

Claudin-19: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Defects in CLDN19 are the cause of hypomagnesemia renal with ocular involvement (HOMG5). HOMG5 is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. The renal phenotype is virtually undistinguishable from that of patients with HOMG3 with proven CLDN16 mutations. Belongs to the claudin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p34.2

Cellular Component: apical junction complex; tight junction; basolateral plasma membrane; cytoplasm; integral to membrane; nucleus

Molecular Function: identical protein binding; structural molecule activity

Biological Process: apical junction assembly; visual perception; response to stimulus; action potential propagation; calcium-independent cell-cell adhesion

Disease: Hypomagnesemia 5, Renal, With Ocular Involvement

Research Articles on CLDN19

Similar Products

Product Notes

The CLDN19 cldn19 (Catalog #AAA5300212) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Claudin 19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CLDN19 cldn19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Claudin 19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.