Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TRNT1 antibody (MBS5300157) used at 2.5 ug/ml to detect target protein.)

Rabbit TRNT1 Polyclonal Antibody | anti-TRNT1 antibody

TRNT1 antibody

Gene Names
TRNT1; CCA1; SIFD; MtCCA; CGI-47
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
TRNT1; Polyclonal Antibody; TRNT1 antibody; Polyclonal TRNT1; Anti-TRNT1; TRNT 1; TRNT-1; tRNA Nucleotidyl Transferase Cca-Adding 1; anti-TRNT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
TRNT1 antibody was raised against the N terminal of TRNT1
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TRNT1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
405
Applicable Applications for anti-TRNT1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 2.5 ug/ml
IHC: 16 ug/ml
Biological Significance
TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
Cross-Reactivity
Human
Immunogen
TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(TRNT1 antibody (MBS5300157) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (TRNT1 antibody (MBS5300157) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-TRNT1 antibody
Rabbit polyclonal TRNT1 antibody raised against the N terminal of TRNT1
Product Categories/Family for anti-TRNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45 kDa (MW of target protein)
NCBI Official Full Name
TRNT1 protein
NCBI Official Synonym Full Names
tRNA nucleotidyl transferase, CCA-adding, 1
NCBI Official Symbol
TRNT1
NCBI Official Synonym Symbols
CCA1; SIFD; MtCCA; CGI-47
NCBI Protein Information
CCA tRNA nucleotidyltransferase 1, mitochondrial
UniProt Protein Name
CCA tRNA nucleotidyltransferase 1, mitochondrial
UniProt Gene Name
TRNT1
UniProt Entry Name
TRNT1_HUMAN

NCBI Description

The protein encoded by this gene is a CCA-adding enzyme which belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. This essential enzyme functions by catalyzing the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules. Mutations in this gene result in sideroblastic anemia with B-cell immunodeficiency, periodic fevers, and developmental delay. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

TRNT1: Isoform 1: Adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates. Belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Transferase; EC 2.7.7.72; RNA processing

Chromosomal Location of Human Ortholog: 3p25.1

Cellular Component: mitochondrion; intracellular

Molecular Function: tRNA adenylyltransferase activity; ATP binding; tRNA binding

Biological Process: tRNA 3'-terminal CCA addition; tRNA 3'-end processing; protein targeting to mitochondrion

Disease: Sideroblastic Anemia With B-cell Immunodeficiency, Periodic Fevers, And Developmental Delay

Research Articles on TRNT1

Similar Products

Product Notes

The TRNT1 trnt1 (Catalog #AAA5300157) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRNT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 2.5 ug/ml IHC: 16 ug/ml. Researchers should empirically determine the suitability of the TRNT1 trnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRNT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.