Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KAT2BSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse KAT2B Polyclonal Antibody | anti-KAT2B antibody

KAT2B Antibody-N-terminal region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KAT2B; Polyclonal Antibody; KAT2B Antibody-N-terminal region; histone acetyltransferase KAT2B; Pcaf; p/CAF; AI461839; AW536563; A930006P13Rik; anti-KAT2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
SCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVS
Applicable Applications for anti-KAT2B antibody
Western Blot (WB)
Protein Size
813 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse KAT2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KAT2BSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KAT2BSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KAT2B antibody
Description of Target: Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Also acetylates non-histone proteins, such as ACLY, PLK4 and TBX5. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators: NPAS2-ARNTL/BMAL1 and CLOCK-ARNTL/BMAL1 heterodimers. Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5. Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
89kDa
UniProt Protein Name
Histone acetyltransferase KAT2B
Protein Family
UniProt Gene Name
Kat2b
UniProt Synonym Gene Names
Pcaf; Histone acetylase PCAF; P/CAF
UniProt Entry Name
KAT2B_MOUSE

Uniprot Description

PCAF: Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Interacts with SIRT1. Interacts (unsumoylated form) with NR2C1; the interaction promotes transactivation activity. Interacts with EP300, CREBBP and DDX17. Interacts with NCOA1 and NCOA3. Component of a large chromatin remodeling complex, at least composed of MYSM1, KAT2B/PCAF, RBM10 and KIF11/TRIP5. Interacts with NR2C2 (hypophosphorylated and unsumoylated form); the interaction promotes the transactivation activity of NR2C2. Binds to HTLV-1 Tax. Interacts with and acetylates HIV-1 Tat. Interacts with KLF1; the interaction does not acetylate KLF1 and there is no enhancement of its transactivational activity. Interacts with NFE4. Interacts with MECOM. Interacts with E2F1; the interaction acetylates E2F1 augmenting its DNA-binding and transcriptional activity. Ubiquitously expressed but most abundant in heart and skeletal muscle. Belongs to the GCN5 family.

Protein type: EC 2.3.1.48; Nuclear receptor co-regulator; Acetyltransferase

Cellular Component: kinetochore; I band; nuclear chromatin; actomyosin; nucleus; cytosol; histone acetyltransferase complex; A band

Molecular Function: cyclin-dependent protein kinase inhibitor activity; lysine N-acetyltransferase activity; N-acetyltransferase activity; histone deacetylase binding; transcription coactivator activity; protein kinase binding; transcription factor binding; transferase activity; histone acetyltransferase binding; protein binding; histone acetyltransferase activity; acetyltransferase activity; transferase activity, transferring acyl groups; transcription cofactor activity; protein complex binding; chromatin binding

Biological Process: internal peptidyl-lysine acetylation; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; rhythmic process; negative regulation of cyclin-dependent protein kinase activity; cell cycle; positive regulation of vasodilation; chromatin remodeling; negative regulation of cell proliferation; protein amino acid acetylation; cellular response to insulin stimulus; regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; histone acetylation; peptidyl-lysine acetylation; N-terminal peptidyl-lysine acetylation

Similar Products

Product Notes

The KAT2B kat2b (Catalog #AAA3249822) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KAT2B Antibody-N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KAT2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KAT2B kat2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SCKCNGWKNP NPSPTPPRGD LQQIIVSLTE SCRSCSHALA AHVSHLENVS. It is sometimes possible for the material contained within the vial of "KAT2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.