Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KAT2BSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KAT2B Polyclonal Antibody | anti-KAT2B antibody

KAT2B Antibody - C-terminal region

Gene Names
KAT2B; CAF; PCAF; P/CAF
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KAT2B; Polyclonal Antibody; KAT2B Antibody - C-terminal region; anti-KAT2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFME
Sequence Length
832
Applicable Applications for anti-KAT2B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KAT2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KAT2BSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KAT2BSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KAT2B antibody
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91 kDa
NCBI Official Full Name
histone acetyltransferase KAT2B
NCBI Official Synonym Full Names
lysine acetyltransferase 2B
NCBI Official Symbol
KAT2B
NCBI Official Synonym Symbols
CAF; PCAF; P/CAF
NCBI Protein Information
histone acetyltransferase KAT2B
UniProt Protein Name
Histone acetyltransferase KAT2B
Protein Family
UniProt Gene Name
KAT2B
UniProt Synonym Gene Names
PCAF; Histone acetylase PCAF; P/CAF
UniProt Entry Name
KAT2B_HUMAN

NCBI Description

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq, Jul 2008]

Uniprot Description

PCAF: Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Interacts with SIRT1. Interacts (unsumoylated form) with NR2C1; the interaction promotes transactivation activity. Interacts with EP300, CREBBP and DDX17. Interacts with NCOA1 and NCOA3. Component of a large chromatin remodeling complex, at least composed of MYSM1, KAT2B/PCAF, RBM10 and KIF11/TRIP5. Interacts with NR2C2 (hypophosphorylated and unsumoylated form); the interaction promotes the transactivation activity of NR2C2. Binds to HTLV-1 Tax. Interacts with and acetylates HIV-1 Tat. Interacts with KLF1; the interaction does not acetylate KLF1 and there is no enhancement of its transactivational activity. Interacts with NFE4. Interacts with MECOM. Interacts with E2F1; the interaction acetylates E2F1 augmenting its DNA-binding and transcriptional activity. Ubiquitously expressed but most abundant in heart and skeletal muscle. Belongs to the GCN5 family.

Protein type: Acetyltransferase; Nuclear receptor co-regulator; EC 2.3.1.48

Chromosomal Location of Human Ortholog: 3p24

Cellular Component: kinetochore; nucleoplasm; I band; PCAF complex; actomyosin; nucleus; A band

Molecular Function: lysine N-acetyltransferase activity; cyclin-dependent protein kinase inhibitor activity; protein binding; histone acetyltransferase activity; histone deacetylase binding; transcription coactivator activity; acetyltransferase activity; protein complex binding; transcription cofactor activity; transcription factor binding; protein kinase binding

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; establishment and/or maintenance of chromatin architecture; internal peptidyl-lysine acetylation; viral reproduction; negative regulation of cyclin-dependent protein kinase activity; rhythmic process; transcription from RNA polymerase I promoter; chromatin remodeling; negative regulation of cell proliferation; protein amino acid acetylation; cellular response to insulin stimulus; gene expression; positive regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase I promoter; cell cycle arrest; peptidyl-lysine acetylation; N-terminal peptidyl-lysine acetylation

Research Articles on KAT2B

Similar Products

Product Notes

The KAT2B kat2b (Catalog #AAA3219963) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KAT2B Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KAT2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KAT2B kat2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESIPGIRETG WKPSGKEKSK EPRDPDQLYS TLKSILQQVK SHQSAWPFME. It is sometimes possible for the material contained within the vial of "KAT2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.