Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RBL1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 2ug/ml)

Rabbit anti-Human RBL1 Polyclonal Antibody | anti-RBL1 antibody

RBL1 Antibody-C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBL1; Polyclonal Antibody; RBL1 Antibody-C-terminal region; Retinoblastoma-like protein 1; DYRK1B; DYRK1A; CDK2; MAGEA11; E2F1; AR; UBC; RBBP8; E2F4; PLSCR1; NUCB1; LAMB2; NR4A1; GOLGA2; FN1; EPHA2; CDK6; CDK4; AOX1; SP1; SNRPD3; DGKZ; ID2; RINT1; E2F3; E2F2; PPP1CA; TOP1; SMARCA4; CCNA2; LIN9; LIN54; LIN37; MYBL2; MAPK6; IRF3; RBL2; DHX30; NR2; PRB1; p107; CP107; anti-RBL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
Applicable Applications for anti-RBL1 antibody
Western Blot (WB)
Protein Size
1068 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RBL1
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RBL1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 2ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RBL1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 2ug/ml)
Related Product Information for anti-RBL1 antibody
Description of Target: The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
121kDa
UniProt Protein Name
Retinoblastoma-like protein 1
Protein Family
UniProt Gene Name
RBL1
UniProt Synonym Gene Names
p107
UniProt Entry Name
RBL1_HUMAN

Uniprot Description

Rb-like 1: Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation. Forms a complex with adenovirus E1A and with SV40 large T antigen. May bind and modulate functionally certain cellular proteins with which T and E1A compete for pocket binding. May act as a tumor suppressor. Belongs to the retinoblastoma protein (RB) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: protein binding; transcription factor binding

Biological Process: transcription initiation from RNA polymerase II promoter; viral reproduction; transcription, DNA-dependent; regulation of cell cycle; transforming growth factor beta receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; gene expression; mitotic cell cycle; regulation of lipid kinase activity; chromatin modification; negative regulation of transcription from RNA polymerase II promoter

Similar Products

Product Notes

The RBL1 rbl1 (Catalog #AAA3249591) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBL1 Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBL1 rbl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NMIRQGEQRT KKRVIAIDSD AESPAKRVCQ ENDDVLLKRL QDVVSERANH. It is sometimes possible for the material contained within the vial of "RBL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.