JMJD6 blocking peptide
JMJD6 Peptide-C-terminal region
Reactivity
Mouse
Synonyms
JMJD6; JMJD6 Peptide-C-terminal region; PSR; Ptdsr; PtdSerR; mKIAA0585; D11Ertd195e; 5730436I23Rik; JMJD6 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
WYRILKQEHPELAVLADAVDLQESTGIASDSSSDSSSSSSSSSSDSDSEC
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
403 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for JMJD6 blocking peptide
This is a synthetic peptide designed for use in combination with anti-JMJD6 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Description of Target: This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein functions in differentiation of multiple tissues during development, and in anti-inflammatory cytokine signaling. It was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that this protein does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor.
Description of Target: This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein functions in differentiation of multiple tissues during development, and in anti-inflammatory cytokine signaling. It was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that this protein does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
46kDa
UniProt Protein Name
Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
Protein Family
UniProt Gene Name
Jmjd6
UniProt Synonym Gene Names
Kiaa0585; Ptdsr
UniProt Entry Name
JMJD6_MOUSE
Similar Products
Product Notes
The JMJD6 jmjd6 (Catalog #AAA3249503) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The JMJD6 Peptide-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: WYRILKQEHP ELAVLADAVD LQESTGIASD SSSDSSSSSS SSSSDSDSEC. It is sometimes possible for the material contained within the vial of "JMJD6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
