Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AKR1C4 blocking peptide

AKR1C4 Peptide - N-terminal region

Gene Names
AKR1C4; C11; CDR; DD4; CHDR; DD-4; HAKRA; 3-alpha-HSD
Reactivity
Human
Synonyms
AKR1C4; AKR1C4 Peptide - N-terminal region; AKR1C4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHID
Sequence Length
323
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AKR1C4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- AKR1C4 Antibody, made

Target Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the bioreduction of chlordecone, a toxic organochlorine pesticide, to chlordecone alcohol in liver. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Product Categories/Family for AKR1C4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
aldo-keto reductase family 1 member C4
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member C4
NCBI Official Symbol
AKR1C4
NCBI Official Synonym Symbols
C11; CDR; DD4; CHDR; DD-4; HAKRA; 3-alpha-HSD
NCBI Protein Information
aldo-keto reductase family 1 member C4
UniProt Protein Name
Aldo-keto reductase family 1 member C4
UniProt Gene Name
AKR1C4
UniProt Synonym Gene Names
CHDR; CDR; DD-4; DD4
UniProt Entry Name
AK1C4_HUMAN

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the bioreduction of chlordecone, a toxic organochlorine pesticide, to chlordecone alcohol in liver. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008]

Uniprot Description

AKR1C4: Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha- androstan-3-alpha,17-beta-diol (3-alpha-diol). Also has some 20- alpha-hydroxysteroid dehydrogenase activity. The biotransformation of the pesticide chlordecone (kepone) to its corresponding alcohol leads to increased biliary excretion of the pesticide and concomitant reduction of its neurotoxicity since bile is the major excretory route. Defects in AKR1C4 are a cause of 46,XY sex reversal type 8 (SRXY8). A disorder of sex development. Affected individuals have a 46,XY karyotype but present as phenotypically normal females. AKR1C4 mutations may act as modifier of disease severity in SRXY8 patients. A splicing mutation resulting in loss of exon 2 has been found in affected individuals also carrying mutation Val-79 in AKR1C2 (PubMed:21802064). Belongs to the aldo/keto reductase family.

Protein type: Lipid Metabolism - androgen and estrogen; Oxidoreductase; Lipid Metabolism - C21-steroid hormone; Lipid Metabolism - primary bile acid biosynthesis; EC 1.1.1.357; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 1.1.1.225

Chromosomal Location of Human Ortholog: 10p15.1

Cellular Component: cytoplasm; cytosol

Molecular Function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor; electron carrier activity; aldo-keto reductase activity; chlordecone reductase activity; 3(or 17)-alpha-hydroxysteroid dehydrogenase activity; bile acid transmembrane transporter activity; retinal dehydrogenase activity

Biological Process: steroid metabolic process; bile acid and bile salt transport; bile acid biosynthetic process; phototransduction, visible light; bile acid metabolic process; androgen metabolic process; retinoid metabolic process

Disease: 46,xy Sex Reversal 8

Research Articles on AKR1C4

Similar Products

Product Notes

The AKR1C4 akr1c4 (Catalog #AAA3248596) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AKR1C4 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDPKYQRVEL NDGHFMPVLG FGTYAPPEVP RNRAVEVTKL AIEAGFRHID. It is sometimes possible for the material contained within the vial of "AKR1C4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.