Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PPP1R10 blocking peptide

PPP1R10 Peptide - middle region

Gene Names
PPP1R10; p99; FB19; R111; CAT53; PNUTS; PP1R10
Reactivity
Human
Synonyms
PPP1R10; PPP1R10 Peptide - middle region; PPP1R10 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPP
Sequence Length
940
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PPP1R10 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PPP1R10 Antibody, made

Target Description: This gene encodes a protein phosphatase 1 binding protein. The encoded protein plays a role in many cellular processes including cell cycle progression, DNA repair and apoptosis by regulating the activity of protein phosphatase 1. This gene lies within the major histocompatibility complex class I region on chromosome 6, and alternatively spliced transcript variants have been observed for this gene.
Product Categories/Family for PPP1R10 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 1 regulatory subunit 10
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 10
NCBI Official Symbol
PPP1R10
NCBI Official Synonym Symbols
p99; FB19; R111; CAT53; PNUTS; PP1R10
NCBI Protein Information
serine/threonine-protein phosphatase 1 regulatory subunit 10
UniProt Protein Name
Serine/threonine-protein phosphatase 1 regulatory subunit 10
UniProt Gene Name
PPP1R10
UniProt Synonym Gene Names
CAT53; FB19; PNUTS
UniProt Entry Name
PP1RA_HUMAN

NCBI Description

This gene encodes a protein phosphatase 1 binding protein. The encoded protein plays a role in many cellular processes including cell cycle progression, DNA repair and apoptosis by regulating the activity of protein phosphatase 1. This gene lies within the major histocompatibility complex class I region on chromosome 6, and alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

PNUTS: Scaffold protein which mediates the formation of the PTW/PP1 phosphatase complex by providing a binding platform to each component of the complex. The PTW/PP1 phosphatase complex plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Mediates interaction of WDR82 and PPP1CA. Inhibitor of PPP1CA and PPP1CC phosphatase activities. Has inhibitory activity on PPP1CA only when phosphorylated. Binds to mRNA, single-stranded DNA (ssDNA), poly(A) and poly(G) homopolymers.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; chromatin; nucleus

Molecular Function: DNA binding; metal ion binding; protein phosphatase inhibitor activity

Biological Process: transcription, DNA-dependent; protein import into nucleus; negative regulation of catalytic activity

Research Articles on PPP1R10

Similar Products

Product Notes

The PPP1R10 ppp1r10 (Catalog #AAA3247957) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PPP1R10 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPPPRGGDPF WDGPGDPMRG GPMRGGPGPG PGPYHRGRGG RGGNEPPPPP. It is sometimes possible for the material contained within the vial of "PPP1R10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.