Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NF2 blocking peptide

NF2 Peptide - middle region

Gene Names
NF2; ACN; SCH; BANF
Reactivity
Human
Synonyms
NF2; NF2 Peptide - middle region; NF2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVI
Sequence Length
259
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NF2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- NF2 Antibody, made

Target Description: This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts.
Product Categories/Family for NF2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
merlin isoform 1
NCBI Official Synonym Full Names
neurofibromin 2
NCBI Official Symbol
NF2
NCBI Official Synonym Symbols
ACN; SCH; BANF
NCBI Protein Information
merlin
UniProt Protein Name
Merlin
Protein Family
UniProt Gene Name
NF2
UniProt Synonym Gene Names
SCH
UniProt Entry Name
MERL_HUMAN

NCBI Description

This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. [provided by RefSeq, Jul 2008]

Uniprot Description

Merlin: a moesin-ezrin-radizin-like protein. Interacts with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. Expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations are associated with neurofibromatosis type II. Two predominant isoforms and eight minor isoforms are produced by alternatively spliced transcripts.

Protein type: Cytoskeletal; Tumor suppressor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: filopodium membrane; cortical actin cytoskeleton; early endosome; cytoskeleton; extrinsic to membrane; adherens junction; membrane; perinuclear region of cytoplasm; apical part of cell; lamellipodium; cytoplasm; nucleolus; plasma membrane; nucleus; cleavage furrow

Molecular Function: protein binding; actin binding

Biological Process: intercellular junction assembly and maintenance; negative regulation of MAPKKK cascade; hippocampus development; regulation of protein stability; negative regulation of tyrosine phosphorylation of Stat5 protein; negative regulation of cell-matrix adhesion; odontogenesis of dentine-containing teeth; negative regulation of cell proliferation; Schwann cell proliferation; mesoderm formation; negative regulation of DNA replication; positive regulation of stress fiber formation; ectoderm development; negative regulation of tyrosine phosphorylation of Stat3 protein; negative regulation of protein kinase activity; negative regulation of cell-cell adhesion; actin cytoskeleton organization and biogenesis; positive regulation of cell differentiation; negative regulation of cell migration; negative regulation of JAK-STAT cascade

Disease: Meningioma, Familial, Susceptibility To; Neurofibromatosis, Type Ii; Schwannomatosis 1

Research Articles on NF2

Similar Products

Product Notes

The NF2 nf2 (Catalog #AAA3247843) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NF2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: QILDEKIYCP PEASVLLASY AVQAKYGDYD PSVHKRGFLA QEELLPKRVI. It is sometimes possible for the material contained within the vial of "NF2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.