Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NFIA blocking peptide

NFIA Peptide - middle region

Gene Names
NFIA; CTF; NF1-A; NFI-A; NFI-L; BRMUTD; NF-I/A
Reactivity
Human
Synonyms
NFIA; NFIA Peptide - middle region; NFIA blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPN
Sequence Length
509
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NFIA blocking peptide
This is a synthetic peptide designed for use in combination with anti- NFIA Antibody, made

Target Description: This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for NFIA blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
nuclear factor 1 A-type isoform 1
NCBI Official Synonym Full Names
nuclear factor I A
NCBI Official Symbol
NFIA
NCBI Official Synonym Symbols
CTF; NF1-A; NFI-A; NFI-L; BRMUTD; NF-I/A
NCBI Protein Information
nuclear factor 1 A-type
UniProt Protein Name
Nuclear factor 1 A-type
Protein Family
UniProt Gene Name
NFIA
UniProt Synonym Gene Names
KIAA1439; NF1-A; Nuclear factor 1/A; CTF; NF-I/A; NFI-A
UniProt Entry Name
NFIA_HUMAN

NCBI Description

This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

NFI-A: Recognizes and binds the palindromic sequence 5'- TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. Belongs to the CTF/NF-I family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 1p31.3-p31.2

Cellular Component: nucleoplasm; nucleus; cell junction

Molecular Function: transcription factor binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; viral genome replication; DNA replication; response to organic cyclic substance

Research Articles on NFIA

Similar Products

Product Notes

The NFIA nfia (Catalog #AAA3247774) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NFIA Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSQPSDADIK DQPENGHLGF QDSFVTSGVF SVTELVRVSQ TPIAAGTGPN. It is sometimes possible for the material contained within the vial of "NFIA, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.