Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

P3H2 blocking peptide

P3H2 Peptide - middle region

Gene Names
P3H2; MCVD; MLAT4; LEPREL1
Reactivity
Human
Synonyms
P3H2; P3H2 Peptide - middle region; P3H2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QLNGTQRVLLDNVLSEEQCRELHSVASGIMLVGDGYRGKTSPHTPNEKFE
Sequence Length
527
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for P3H2 blocking peptide
This gene encodes a member of the prolyl 3-hydroxylase subfamily of 2-oxo-glutarate-dependent dioxygenases. These enzymes play a critical role in collagen chain assembly, stability and cross-linking by catalyzing post-translational 3-hydroxylation of proline residues. Mutations in this gene are associated with nonsyndromic severe myopia with cataract and vitreoretinal degeneration, and downregulation of this gene may play a role in breast cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for P3H2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
prolyl 3-hydroxylase 2 isoform b
NCBI Official Synonym Full Names
prolyl 3-hydroxylase 2
NCBI Official Symbol
P3H2
NCBI Official Synonym Symbols
MCVD; MLAT4; LEPREL1
NCBI Protein Information
prolyl 3-hydroxylase 2
UniProt Protein Name
Prolyl 3-hydroxylase 2
Protein Family
UniProt Gene Name
LEPREL1
UniProt Synonym Gene Names
MLAT4; P3H2
UniProt Entry Name
P3H2_HUMAN

NCBI Description

This gene encodes a member of the prolyl 3-hydroxylase subfamily of 2-oxo-glutarate-dependent dioxygenases. These enzymes play a critical role in collagen chain assembly, stability and cross-linking by catalyzing post-translational 3-hydroxylation of proline residues. Mutations in this gene are associated with nonsyndromic severe myopia with cataract and vitreoretinal degeneration, and downregulation of this gene may play a role in breast cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

LEPREL1: Shows prolyl 3-hydroxylase activity catalyzing the post- translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types II, IV and V. Defects in LEPREL1 are the cause of myopia high with cataract and vitreoretinal degeneration (MCVD). A disorder characterized by severe myopia with variable expressivity of cataract and vitreoretinal degeneration. Some patients manifest lens subluxation, lens instability and retinal detachment. Belongs to the leprecan family.

Protein type: Oxidoreductase; EC 1.14.11.7

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: Golgi apparatus; endoplasmic reticulum; endoplasmic reticulum lumen; basement membrane

Molecular Function: procollagen-proline 3-dioxygenase activity; L-ascorbic acid binding; iron ion binding

Biological Process: negative regulation of cell proliferation; extracellular matrix organization and biogenesis; collagen metabolic process; peptidyl-proline hydroxylation

Disease: Myopia, High, With Cataract And Vitreoretinal Degeneration

Research Articles on P3H2

Similar Products

Product Notes

The P3H2 leprel1 (Catalog #AAA3247356) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The P3H2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLNGTQRVLL DNVLSEEQCR ELHSVASGIM LVGDGYRGKT SPHTPNEKFE. It is sometimes possible for the material contained within the vial of "P3H2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.