CPNE3 blocking peptide
CPNE3 Peptide - middle region
Gene Names
DNAJC11; dJ126A5.1
Reactivity
Human
Synonyms
CPNE3; CPNE3 Peptide - middle region; CPNE3 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVSGSSF
Sequence Length
521
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CPNE3 blocking peptide
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands.
Product Categories/Family for CPNE3 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 11
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C11
NCBI Official Symbol
DNAJC11
NCBI Official Synonym Symbols
dJ126A5.1
NCBI Protein Information
dnaJ homolog subfamily C member 11
UniProt Protein Name
DnaJ homolog subfamily C member 11
Protein Family
UniProt Gene Name
DNAJC11
UniProt Entry Name
DJC11_HUMAN
Uniprot Description
Sequence similarities: Belongs to the DNAJC11 family.Contains 1 J domain.
Sequence caution: The sequence AAH08772.1 differs from that shown. Reason: Erroneous initiation.
Research Articles on CPNE3
Similar Products
Product Notes
The CPNE3 dnajc11 (Catalog #AAA3246863) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CPNE3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEFERLQRER EERRLQQRTN PKGTISVGVD ATDLFDRYDE EYEDVSGSSF. It is sometimes possible for the material contained within the vial of "CPNE3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
