RPP38 blocking peptide

RPP38 Peptide - C-terminal region

Cat. Num. AAA3246829

• Reactivity: Human
• Synonyms: RPP38; RPP38 Peptide - C-terminal region; RPP38 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKA
• Sequence Length: 283

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for RPP38 blocking peptide

This is a synthetic peptide designed for use in combination with anti- RPP38 Antibody, made

Target Description: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. RPP38 may associate transiently with RNase P RNA as a factor involved in the transport of H1 RNA to the putative site of its assembly in the cell, the nucleolus.

Product Categories/Family for RPP38 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 148222745
• NCBI GeneID: 10557
• NCBI Accession #: NP_001091059.1
• NCBI GenBank Nucleotide #: NM_001097590.2
• UniProt Accession #: P78345
• Molecular Weight: 31 kDa
• NCBI Official Full Name: ribonuclease P protein subunit p38
• NCBI Official Synonym Full Names: ribonuclease P/MRP subunit p38
• NCBI Official Symbol: RPP38
• NCBI Protein Information: ribonuclease P protein subunit p38
• UniProt Protein Name: Ribonuclease P protein subunit p38
• Protein Family: Ribonuclease P protein
• UniProt Gene Name: RPP38
• UniProt Synonym Gene Names: RNaseP protein p38
• UniProt Entry Name: RPP38_HUMAN