Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EIF5B blocking peptide

EIF5B Peptide - middle region

Gene Names
EIF5B; IF2
Reactivity
Human
Synonyms
EIF5B; EIF5B Peptide - middle region; EIF5B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERERKKRD
Sequence Length
1220
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EIF5B blocking peptide
This is a synthetic peptide designed for use in combination with anti- EIF5B Antibody, made

Target Description: Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately.
Product Categories/Family for EIF5B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134 kDa
NCBI Official Full Name
eukaryotic translation initiation factor 5B
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 5B
NCBI Official Symbol
EIF5B
NCBI Official Synonym Symbols
IF2
NCBI Protein Information
eukaryotic translation initiation factor 5B
UniProt Protein Name
Eukaryotic translation initiation factor 5B
UniProt Gene Name
EIF5B
UniProt Synonym Gene Names
IF2; KIAA0741; eIF-5B
UniProt Entry Name
IF2P_HUMAN

NCBI Description

Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. [provided by RefSeq, Jul 2008]

Uniprot Description

EIF5B: Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2. Belongs to the IF-2 family.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 2q11.2

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: GTPase activity; protein binding; GTP binding; translation initiation factor activity

Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression; regulation of translational initiation

Research Articles on EIF5B

Similar Products

Product Notes

The EIF5B eif5b (Catalog #AAA3246478) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EIF5B Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSRKGQKKNQ KNKPGPNIES GNEDDDASFK IKTVAQKKAE KKERERKKRD. It is sometimes possible for the material contained within the vial of "EIF5B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.