Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IGF2R blocking peptide

IGF2R Peptide - middle region

Gene Names
IGF2R; MPR1; MPRI; CD222; CIMPR; M6P-R; MPR300; CI-M6PR; MPR 300; M6P/IGF2R
Reactivity
Human
Synonyms
IGF2R; IGF2R Peptide - middle region; IGF2R blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERHTPRATLITFL
Sequence Length
2491
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IGF2R blocking peptide
This is a synthetic peptide designed for use in combination with anti- IGF2R Antibody, made

Target Description: This gene encodes a receptor for both insulin-like growth factor 2 and mannose 6-phosphate. The binding sites for each ligand are located on different segments of the protein. This receptor has various functions, including in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of insulin-like growth factor 2. Mutation or loss of heterozygosity of this gene has been association with risk of hepatocellular carcinoma. The orthologous mouse gene is imprinted and shows exclusive expression from the maternal allele; however, imprinting of the human gene may be polymorphic, as only a minority of individuals showed biased expression from the maternal allele.
Product Categories/Family for IGF2R blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
274 kDa
NCBI Official Full Name
cation-independent mannose-6-phosphate receptor
NCBI Official Synonym Full Names
insulin like growth factor 2 receptor
NCBI Official Symbol
IGF2R
NCBI Official Synonym Symbols
MPR1; MPRI; CD222; CIMPR; M6P-R; MPR300; CI-M6PR; MPR 300; M6P/IGF2R
NCBI Protein Information
cation-independent mannose-6-phosphate receptor
UniProt Protein Name
Cation-independent mannose-6-phosphate receptor
UniProt Gene Name
IGF2R
UniProt Synonym Gene Names
MPRI; CI Man-6-P receptor; CI-MPR; M6PR; MPR 300; IGF-II receptor; M6P/IGF2R
UniProt Entry Name
MPRI_HUMAN

NCBI Description

This gene encodes a receptor for both insulin-like growth factor 2 and mannose 6-phosphate. The binding sites for each ligand are located on different segments of the protein. This receptor has various functions, including in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of insulin-like growth factor 2. Mutation or loss of heterozygosity of this gene has been association with risk of hepatocellular carcinoma. The orthologous mouse gene is imprinted and shows exclusive expression from the maternal allele; however, imprinting of the human gene may be polymorphic, as only a minority of individuals showed biased expression from the maternal allele (PMID:8267611). [provided by RefSeq, Nov 2015]

Uniprot Description

IGF2R: a multifunctional type I transmembrane protein receptor that binds insulin-like growth factor 2 at the cell surface and mannose-6-phosphate-tagged proteins in the trans-Golgi network. Also known as the cation-independent mannose-6 phosphate (M6P) receptor. Clears IGF2 from the cell surface to attenuate signaling, and transports M6P-tagged lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. M6P-tagged lysosomal enzymes bind specifically to mannose-6- phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. Acts as a positive regulator of T-cell coactivation, by binding DPP4. Belongs to the MRL1/IGF2R family.

Protein type: Receptor, misc.; Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q26

Cellular Component: extracellular space; cell surface; clathrin coat; focal adhesion; lysosomal membrane; integral to plasma membrane; trans-Golgi network; trans-Golgi network transport vesicle; membrane; nuclear envelope lumen; perinuclear region of cytoplasm; endocytic vesicle; late endosome; endosome

Molecular Function: G-protein coupled receptor activity; identical protein binding; mannose binding; protein binding; retinoic acid binding; enzyme binding; transporter activity; G-protein alpha-subunit binding; phosphoprotein binding; receptor activity; glycoprotein binding; insulin-like growth factor II binding; insulin-like growth factor receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; receptor-mediated endocytosis; organ regeneration; response to retinoic acid; insulin-like growth factor receptor signaling pathway; positive regulation of apoptosis; spermatogenesis; signal transduction; liver development; post-embryonic development

Disease: Hepatocellular Carcinoma

Research Articles on IGF2R

Similar Products

Product Notes

The IGF2R igf2r (Catalog #AAA3246224) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IGF2R Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAKSDEKTWN LGLSNAKLSY YDGMIQLNYR GGTPYNNERH TPRATLITFL. It is sometimes possible for the material contained within the vial of "IGF2R, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.