Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

POLR3D blocking peptide

POLR3D Peptide - N-terminal region

Gene Names
POLR3D; RPC4; BN51T; RPC53; TSBN51
Reactivity
Human
Synonyms
POLR3D; POLR3D Peptide - N-terminal region; POLR3D blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRP
Sequence Length
398
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for POLR3D blocking peptide
This is a synthetic peptide designed for use in combination with anti- POLR3D Antibody, made

Target Description: This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures.
Product Categories/Family for POLR3D blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
661
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
DNA-directed RNA polymerase III subunit RPC4
NCBI Official Synonym Full Names
RNA polymerase III subunit D
NCBI Official Symbol
POLR3D
NCBI Official Synonym Symbols
RPC4; BN51T; RPC53; TSBN51
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC4
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC4
UniProt Gene Name
POLR3D
UniProt Synonym Gene Names
BN51; BN51T; RNA polymerase III subunit C4
UniProt Entry Name
RPC4_HUMAN

NCBI Description

This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures. [provided by RefSeq, Jul 2008]

Uniprot Description

POLR3D: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Belongs to the eukaryotic RPC4/POLR3D RNA polymerase subunit family.

Protein type: Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; cytoplasm; nuclear chromatin; cytosol

Molecular Function: DNA binding; chromatin binding

Biological Process: transcription from RNA polymerase III promoter; termination of RNA polymerase III transcription; positive regulation of innate immune response; positive regulation of interferon-beta production; positive regulation of interferon type I production; innate immune response; gene expression; defense response to virus; RNA elongation from RNA polymerase III promoter

Research Articles on POLR3D

Similar Products

Product Notes

The POLR3D polr3d (Catalog #AAA3244730) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The POLR3D Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGVKKKTFTP NIISRKIKEE PKEEVTVKKE KRERDRDRQR EGHGRGRGRP. It is sometimes possible for the material contained within the vial of "POLR3D, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.