Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC7A2 blocking peptide

SLC7A2 Peptide - C-terminal region

Gene Names
SLC7A2; CAT2; ATRC2; HCAT2
Reactivity
Human
Applications
Western Blot
Synonyms
SLC7A2; SLC7A2 Peptide - C-terminal region; SLC7A2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GFLIYFSYGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPR
Sequence Length
658
Applicable Applications for SLC7A2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC7A2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC7A2 Antibody, made
Product Categories/Family for SLC7A2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72 kDa
NCBI Official Full Name
cationic amino acid transporter 2 isoform 2
NCBI Official Synonym Full Names
solute carrier family 7 member 2
NCBI Official Symbol
SLC7A2
NCBI Official Synonym Symbols
CAT2; ATRC2; HCAT2
NCBI Protein Information
cationic amino acid transporter 2
UniProt Protein Name
Cationic amino acid transporter 2
UniProt Gene Name
SLC7A2
UniProt Synonym Gene Names
ATRC2; CAT2; CAT-2; CAT2
UniProt Entry Name
CTR2_HUMAN

NCBI Description

The protein encoded by this gene is a cationic amino acid transporter and a member of the APC (amino acid-polyamine-organocation) family of transporters. The encoded membrane protein is responsible for the cellular uptake of arginine, lysine and ornithine. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

SLC7A2: Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages. Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Transporter, SLC family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: high affinity arginine transmembrane transporter activity; high affinity lysine transmembrane transporter activity; basic amino acid transmembrane transporter activity

Biological Process: amino acid metabolic process; macrophage activation; transport; amino acid transport; regulation of macrophage activation; production of nitric oxide during acute inflammatory response; regulation of inflammatory response; ion transport; nitric oxide biosynthetic process; transmembrane transport

Research Articles on SLC7A2

Similar Products

Product Notes

The SLC7A2 slc7a2 (Catalog #AAA3244698) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC7A2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC7A2 slc7a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFLIYFSYGI RHSLEGHLRD ENNEEDAYPD NVHAAAEEKS AIQANDHHPR. It is sometimes possible for the material contained within the vial of "SLC7A2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.