Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATF7 blocking peptide

ATF7 Peptide - middle region

Gene Names
ATF7; ATFA
Reactivity
Human
Applications
Western Blot
Synonyms
ATF7; ATF7 Peptide - middle region; ATF7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GYDPLHPTLPSPTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPG
Sequence Length
473
Applicable Applications for ATF7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATF7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATF7 Antibody, made

Target Description: Isoform 5/ATF-4 acts as a negative regulator, inhibiting both ATF2 and ATF7 transcriptional activities. It may exert these effects by sequestrating in the cytoplasm the Thr-53 phosphorylating kinase, preventing activation. FUNCTION: Isoform 4/ATF-A0 acts as a dominant repressor of the E- selectin/NF-ELAM1/delta-A promoter.ATF7 Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]- 3'), a sequence present in many viral and cellular promoters. Activator of the NF-ELAM1/delta-A site of the E-selectin promoter. Has no intrinsic transcriptional activity, but activates transcription on formation of JUN or FOS heterodimers. Also can bind TRE promoter sequences when heterodimerized with members of the JUN family.
Product Categories/Family for ATF7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-7 isoform 3
NCBI Official Synonym Full Names
activating transcription factor 7
NCBI Official Symbol
ATF7
NCBI Official Synonym Symbols
ATFA
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-7
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-7
UniProt Gene Name
ATF7
UniProt Synonym Gene Names
ATFA; cAMP-dependent transcription factor ATF-7
UniProt Entry Name
ATF7_HUMAN

Uniprot Description

ATF7: Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]- 3'), a sequence present in many viral and cellular promoters. Activator of the NF-ELAM1/delta-A site of the E-selectin promoter. Has no intrinsic transcriptional activity, but activates transcription on formation of JUN or FOS heterodimers. Also can bind TRE promoter sequences when heterodimerized with members of the JUN family. Belongs to the bZIP family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; enzyme binding; sequence-specific DNA binding; metal ion binding; mitogen-activated protein kinase binding; transcription factor binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; viral reproduction; negative regulation of transcription from RNA polymerase II promoter

Research Articles on ATF7

Similar Products

Product Notes

The ATF7 atf7 (Catalog #AAA3244531) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATF7 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATF7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATF7 atf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYDPLHPTLP SPTSVITQAP PSNRQMGSPT GSLPLVMHLA NGQTMPVLPG. It is sometimes possible for the material contained within the vial of "ATF7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.