Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TUSC3 blocking peptide

TUSC3 Peptide - N-terminal region

Gene Names
TUSC3; M33; N33; MRT7; MRT22; MagT2; OST3A; D8S1992
Reactivity
Human
Synonyms
TUSC3; TUSC3 Peptide - N-terminal region; TUSC3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEK
Sequence Length
348
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TUSC3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TUSC3 Antibody, made

Target Description: This gene is a candidate tumor suppressor gene. It is located within a homozygously deleted region of a metastatic prostate cancer. The gene is expressed in most nonlymphoid human tissues including prostate, lung, liver, and colon. Expression was also detected in many epithelial tumor cell lines. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for TUSC3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Synonym Full Names
tumor suppressor candidate 3
NCBI Official Symbol
TUSC3
NCBI Official Synonym Symbols
M33; N33; MRT7; MRT22; MagT2; OST3A; D8S1992
NCBI Protein Information
tumor suppressor candidate 3
UniProt Protein Name
Tumor suppressor candidate 3
UniProt Gene Name
TUSC3
UniProt Synonym Gene Names
N33
UniProt Entry Name
TUSC3_HUMAN

NCBI Description

This gene encodes a protein that has been associated with several biological functions including cellular magnesium uptake, protein glycosylation and embryonic development. This protein localizes to the endoplasmic reticulum and acts as a component of the oligosaccharyl transferase complex which is responsible for N-linked protein glycosylation. This gene is a candidate tumor suppressor gene. Homozygous mutations in this gene are associated with autosomal recessive nonsyndromic mental retardation-7 and in the proliferation and invasiveness of several cancers including metastatic pancreatic cancer, ovarian cancer and glioblastoma multiform. [provided by RefSeq, Oct 2017]

Uniprot Description

TUSC3: Magnesium transporter. May be involved in N- glycosylation through its association with N-oligosaccharyl transferase. Defects in TUSC3 are the cause of mental retardation autosomal recessive type 7 (MRT7); also known as mental retardation non-syndromic autosomal recessive 7. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non- syndromic mental retardation patients do not manifest other clinical signs. Belongs to the OST3/OST6 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: endoplasmic reticulum membrane; mitochondrion; integral to plasma membrane; oligosaccharyl transferase complex

Molecular Function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity; magnesium ion transmembrane transporter activity

Biological Process: cellular protein metabolic process; cell redox homeostasis; protein amino acid N-linked glycosylation; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; cognition; magnesium ion transport

Disease: Mental Retardation, Autosomal Recessive 7

Research Articles on TUSC3

Similar Products

Product Notes

The TUSC3 tusc3 (Catalog #AAA3244496) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TUSC3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARGAPSRRRQ AGRRLRYLPT GSFPFLLLLL LLCIQLGGGQ KKKENLLAEK. It is sometimes possible for the material contained within the vial of "TUSC3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.