Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EPCAM blocking peptide

EPCAM Peptide - N-terminal region

Gene Names
EPCAM; ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1
Reactivity
Human
Applications
Western Blot
Synonyms
EPCAM; EPCAM Peptide - N-terminal region; EPCAM blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTD
Sequence Length
314
Applicable Applications for EPCAM blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EPCAM blocking peptide
This is a synthetic peptide designed for use in combination with anti-EPCAM Antibody, made

Target Description: This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Product Categories/Family for EPCAM blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
epithelial cell adhesion molecule
NCBI Official Synonym Full Names
epithelial cell adhesion molecule
NCBI Official Symbol
EPCAM
NCBI Official Synonym Symbols
ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1
NCBI Protein Information
epithelial cell adhesion molecule
UniProt Protein Name
Epithelial cell adhesion molecule
UniProt Gene Name
EPCAM
UniProt Synonym Gene Names
GA733-2; M1S2; M4S1; MIC18; TACSTD1; TROP1; Ep-CAM; EGP; EGP314; hEGP314
UniProt Entry Name
EPCAM_HUMAN

NCBI Description

This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008]

Uniprot Description

EPCAM: a single-pass type I membrane protein of the EPCAM family. May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinomas including pancreatic carcinoma. May be a marker of cancer stem cells.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: tight junction; cell surface; basolateral plasma membrane; apical plasma membrane; integral to membrane; plasma membrane; lateral plasma membrane

Molecular Function: protein binding; protein complex binding

Biological Process: ureteric bud development; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; stem cell differentiation

Disease: Diarrhea 5, With Tufting Enteropathy, Congenital; Colorectal Cancer, Hereditary Nonpolyposis, Type 8

Research Articles on EPCAM

Similar Products

Product Notes

The EPCAM epcam (Catalog #AAA3244326) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EPCAM Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPCAM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EPCAM epcam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRRAKPEGAL QNNDGLYDPD CDESGLFKAK QCNGTSMCWC VNTAGVRRTD. It is sometimes possible for the material contained within the vial of "EPCAM, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.