Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CDKAL1 blocking peptide

CDKAL1 Peptide - N-terminal region

Reactivity
Human
Applications
Western Blot
Synonyms
CDKAL1; CDKAL1 Peptide - N-terminal region; CDKAL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWI
Sequence Length
579
Applicable Applications for CDKAL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CDKAL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CDKAL1 Antibody, made

Target Description: The protein encoded by this gene is a member of the methylthiotransferase family. The function of this gene is not known. Genome-wide association studies have linked single nucleotide polymorphisms in an intron of this gene with susceptibilty to type 2 diabetes.
Product Categories/Family for CDKAL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
threonylcarbamoyladenosine tRNA methylthiotransferase
NCBI Official Synonym Full Names
CDK5 regulatory subunit associated protein 1 like 1
NCBI Official Symbol
CDKAL1
NCBI Protein Information
threonylcarbamoyladenosine tRNA methylthiotransferase
UniProt Protein Name
Threonylcarbamoyladenosine tRNA methylthiotransferase
UniProt Gene Name
CDKAL1
UniProt Entry Name
CDKAL_HUMAN

NCBI Description

The protein encoded by this gene is a member of the methylthiotransferase family. The function of this gene is not known. Genome-wide association studies have linked single nucleotide polymorphisms in an intron of this gene with susceptibilty to type 2 diabetes. [provided by RefSeq, May 2010]

Uniprot Description

CDKAL1: Catalyzes the methylthiolation of N6- threonylcarbamoyladenosine (t(6)A), leading to the formation of 2- methylthio-N6-threonylcarbamoyladenosine (ms(2)t(6)A) at position 37 in tRNAs that read codons beginning with adenine. Belongs to the methylthiotransferase family. CDKAL1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Enzyme, misc.; EC 2.8.4.5; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: endoplasmic reticulum membrane; rough endoplasmic reticulum; membrane; integral to membrane

Molecular Function: 4 iron, 4 sulfur cluster binding; metal ion binding

Disease: Diabetes Mellitus, Noninsulin-dependent

Research Articles on CDKAL1

Similar Products

Product Notes

The CDKAL1 cdkal1 (Catalog #AAA3244301) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CDKAL1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDKAL1 cdkal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEDSKPQDRH FVRKDVVPKV RRRNTQKYLQ EEENSPPSDS TIPGIQKIWI. It is sometimes possible for the material contained within the vial of "CDKAL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.