RGS7BP blocking peptide

RGS7BP Peptide - middle region

Cat. Num. AAA3243205

• Gene Names: RGS7BP; R7BP
• Reactivity: Human
• Applications: Western Blot
• Synonyms: RGS7BP; RGS7BP Peptide - middle region; RGS7BP blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKGKEPGGGTKSLDCKIEES
• Sequence Length: 257

• Applicable Applications for RGS7BP blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for RGS7BP blocking peptide

This is a synthetic peptide designed for use in combination with anti-RGS7BP Antibody, made

Target Description: This gene encodes a protein that binds to all members of the R7 subfamily of regulators of G protein signaling and regulates their translocation between the nucleus and the plasma membrane. The encoded protein could be regulated by reversible palmitoylation, which anchors it to the plasma membrane. Depalmitoylation localizes the protein to the nucleus. Polymorphisms in this gene may be associated with risk of aspirin-exacerbated respiratory disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Product Categories/Family for RGS7BP blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 71274166
• NCBI GeneID: 401190
• NCBI Accession #: NP_001025046
• NCBI GenBank Nucleotide #: NM_001029875
• UniProt Accession #: Q6MZT1
• Molecular Weight: 28kDa
• NCBI Official Full Name: regulator of G-protein signaling 7-binding protein isoform 1
• NCBI Official Synonym Full Names: regulator of G protein signaling 7 binding protein
• NCBI Official Symbol: RGS7BP
• NCBI Official Synonym Symbols: R7BP
• NCBI Protein Information: regulator of G-protein signaling 7-binding protein
• UniProt Protein Name: Regulator of G-protein signaling 7-binding protein
• Protein Family: Regulator of G-protein signaling 7-binding protein
• UniProt Gene Name: RGS7BP
• UniProt Synonym Gene Names: R7BP

NCBI Description

This gene encodes a protein that binds to all members of the R7 subfamily of regulators of G protein signaling and regulates their translocation between the nucleus and the plasma membrane. The encoded protein could be regulated by reversible palmitoylation, which anchors it to the plasma membrane. Depalmitoylation localizes the protein to the nucleus. Polymorphisms in this gene may be associated with risk of aspirin-exacerbated respiratory disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

Regulator of G protein-coupled receptor (GPCR) signaling. Regulatory subunit of the R7-Gbeta5 complexes that acts by controlling the subcellular location of the R7-Gbeta5 complexes. When palmitoylated, it targets the R7-Gbeta5 complexes to the plasma membrane, leading to inhibit G protein alpha subunits. When it is unpalmitoylated, the R7-Gbeta5 complexes undergo a nuclear/cypolasmic shuttling. May also act by controlling the proteolytic stability of R7 proteins, probably by protecting them from degradation.