Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TACO1 blocking peptide

TACO1 Peptide - C-terminal region

Gene Names
TACO1; CCDC44
Reactivity
Human
Applications
Western Blot
Synonyms
TACO1; TACO1 Peptide - C-terminal region; TACO1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
NLERALEMAIEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGL
Sequence Length
297
Applicable Applications for TACO1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TACO1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TACO1 Antibody, made

Target Description: This gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome.
Product Categories/Family for TACO1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
translational activator of cytochrome c oxidase 1
NCBI Official Synonym Full Names
translational activator of cytochrome c oxidase I
NCBI Official Symbol
TACO1
NCBI Official Synonym Symbols
CCDC44
NCBI Protein Information
translational activator of cytochrome c oxidase 1
UniProt Protein Name
Translational activator of cytochrome c oxidase 1
UniProt Gene Name
TACO1
UniProt Synonym Gene Names
CCDC44
UniProt Entry Name
TACO1_HUMAN

NCBI Description

This gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome.[provided by RefSeq, Mar 2010]

Uniprot Description

CCDC44: Acts as a translational activator of mitochondrially- encoded cytochrome c oxidase 1. Defects in TACO1 are a cause of Leigh syndrome (LS). LS is a severe neurological disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions that is commonly associated with systemic cytochrome c oxidase (COX) deficiency. Belongs to the TACO1 family.

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: nucleoplasm; mitochondrion; nucleus

Biological Process: regulation of translation

Disease: Mitochondrial Complex Iv Deficiency

Research Articles on TACO1

Similar Products

Product Notes

The TACO1 taco1 (Catalog #AAA3242528) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TACO1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TACO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TACO1 taco1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NLERALEMAI EAGAEDVKET EDEEERNVFK FICDASSLHQ VRKKLDSLGL. It is sometimes possible for the material contained within the vial of "TACO1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.