Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PHAX blocking peptide

PHAX Peptide - middle region

Gene Names
PHAX; RNUXA
Reactivity
Human
Applications
Western Blot
Synonyms
PHAX; PHAX Peptide - middle region; PHAX blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRP
Sequence Length
394
Applicable Applications for PHAX blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PHAX blocking peptide
This is a synthetic peptide designed for use in combination with anti-PHAX Antibody, made

Target Description: PHAX is a phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. PHAX is also a bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other.
Product Categories/Family for PHAX blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
phosphorylated adapter RNA export protein
NCBI Official Synonym Full Names
phosphorylated adaptor for RNA export
NCBI Official Symbol
PHAX
NCBI Official Synonym Symbols
RNUXA
NCBI Protein Information
phosphorylated adapter RNA export protein
UniProt Protein Name
Phosphorylated adapter RNA export protein
UniProt Gene Name
PHAX
UniProt Synonym Gene Names
RNUXA
UniProt Entry Name
PHAX_HUMAN

Uniprot Description

RNUXA: A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation- independent manner. Plays also a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA. Belongs to the PHAX family.

Protein type: Nuclear import; RNA-binding

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: nucleoplasm; Cajal body; intracellular membrane-bound organelle; cell soma; nucleolus; cytosol; nucleus

Molecular Function: toxin binding; RNA binding

Biological Process: spliceosomal snRNP biogenesis; protein transport; snRNA export from nucleus; gene expression

Research Articles on PHAX

Similar Products

Product Notes

The PHAX phax (Catalog #AAA3241697) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PHAX Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHAX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PHAX phax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NYLLAKKLRK ESQEHTKDLD KELDEYMHGG KKMGSKEEEN GQGHLKRKRP. It is sometimes possible for the material contained within the vial of "PHAX, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.