NUP93 blocking peptide

NUP93 Peptide - C-terminal region

Cat. Num. AAA3241531

• Gene Names: NUP93; NIC96
• Reactivity: Human
• Synonyms: NUP93; NUP93 Peptide - C-terminal region; NUP93 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQ
• Sequence Length: 696

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for NUP93 blocking peptide

This is a synthetic peptide designed for use in combination with anti- NUP93 Antibody, made

Target Description: Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. May anchor nucleoporins, but not NUP153 and TPR, to the NPC.

Product Categories/Family for NUP93 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 338753431
• NCBI GeneID: 9688
• NCBI Accession #: NP_001229725
• NCBI GenBank Nucleotide #: NM_001242795.1
• UniProt Accession #: Q8N1F7
• Molecular Weight: 76 kDa
• NCBI Official Synonym Full Names: nucleoporin 93
• NCBI Official Symbol: NUP93
• NCBI Official Synonym Symbols: NIC96
• NCBI Protein Information: nuclear pore complex protein Nup93
• UniProt Protein Name: Nuclear pore complex protein Nup93
• Protein Family: Nuclear pore complex protein
• UniProt Gene Name: NUP93
• UniProt Synonym Gene Names: KIAA0095
• UniProt Entry Name: NUP93_HUMAN

NCBI Description

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene encodes a nucleoporin protein that localizes both to the basket of the pore and to the nuclear entry of the central gated channel of the pore. The encoded protein is a target of caspase cysteine proteases that play a central role in programmed cell death by apoptosis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]

Uniprot Description

NUP93: a nuclear pore protein (nucleoporin) required for correct nuclear pore assembly. The nuclear pore complex, comprised of approximately 30 nucleoporins, mediates the exchange of macromolecules across the nuclear envelope. It is comprised of approximately 30 proteins termed nucleoporins that are each present in multiple copies. Belongs to the nucleoporin interacting component (NIC) family.

Protein type: Nucleoporin

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: nuclear membrane; membrane; nuclear envelope; nuclear pore

Molecular Function: structural constituent of nuclear pore

Biological Process: nuclear pore complex assembly; viral reproduction; cytokine and chemokine mediated signaling pathway; mitotic nuclear envelope disassembly; pathogenesis; glucose transport; viral infectious cycle; poly(A)+ mRNA export from nucleus; protein import into nucleus; hexose transport; carbohydrate metabolic process; gene expression; viral transcription; mitotic cell cycle; transmembrane transport