Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BAP1 blocking peptide

BAP1 Peptide - C-terminal region

Gene Names
BAP1; UCHL2; hucep-6; HUCEP-13
Reactivity
Human
Applications
Western Blot
Synonyms
BAP1; BAP1 Peptide - C-terminal region; BAP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKA
Sequence Length
729
Applicable Applications for BAP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BAP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-BAP1 Antibody, made

Target Description: The protein encoded by this gene localizes to the nucleus and it interacts with the RING finger domain of the breast cancer 1, early onset protein (BRCA1). This gene is thought to be a tumor suppressor gene that functions in the BRCA1 growth control pathway. There are multiple polyadenylation sites found in this gene.
Product Categories/Family for BAP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase BAP1
NCBI Official Synonym Full Names
BRCA1 associated protein 1
NCBI Official Symbol
BAP1
NCBI Official Synonym Symbols
UCHL2; hucep-6; HUCEP-13
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase BAP1
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase BAP1
Protein Family
UniProt Gene Name
BAP1
UniProt Synonym Gene Names
KIAA0272
UniProt Entry Name
BAP1_HUMAN

NCBI Description

This gene belongs to the ubiquitin C-terminal hydrolase subfamily of deubiquitinating enzymes that are involved in the removal of ubiquitin from proteins. The encoded enzyme binds to the breast cancer type 1 susceptibility protein (BRCA1) via the RING finger domain of the latter and acts as a tumor suppressor. In addition, the enzyme may be involved in regulation of transcription, regulation of cell cycle and growth, response to DNA damage and chromatin dynamics. Germline mutations in this gene may be associated with tumor predisposition syndrome (TPDS), which involves increased risk of cancers including malignant mesothelioma, uveal melanoma and cutaneous melanoma. [provided by RefSeq, May 2013]

Uniprot Description

BAP1: Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A and HCFC1. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). Does not deubiquitinate monoubiquitinated histone H2B. Acts as a regulator of cell growth by mediating deubiquitination of HCFC1 N-terminal and C-terminal chains, with some specificity toward 'Lys-48'- linked polyubiquitin chains compared to 'Lys-63'-linked polyubiquitin chains. Deubiquitination of HCFC1 does not lead to increase stability of HCFC1. Interferes with the BRCA1 and BARD1 heterodimer activity by inhibiting their ability to mediate ubiquitination and autoubiquitination. It however does not mediate deubiquitination of BRCA1 and BARD1. Acts as a tumor suppressor. Component of the PR-DUB complex, at least composed of BAP1 and ASXL1. Interacts with BRCA1 (via the RING finger). Interacts (via HBM-like motif) with HCFC1. Highly expressed in testis, placenta and ovary. Expressed in breast. Belongs to the peptidase C12 family. BAP1 subfamily.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12; Tumor suppressor; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: peptidase activity; protein binding; ubiquitin-specific protease activity; chromatin binding

Biological Process: ubiquitin-dependent protein catabolic process; negative regulation of cell proliferation; protein deubiquitination; regulation of cell cycle; protein modification process; regulation of cell growth

Disease: Tumor Predisposition Syndrome

Research Articles on BAP1

Similar Products

Product Notes

The BAP1 bap1 (Catalog #AAA3241096) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BAP1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BAP1 bap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TFISMLAQEG MLANLVEQNI SVRRRQGVSI GRLHKQRKPD RRKRSRPYKA. It is sometimes possible for the material contained within the vial of "BAP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.