Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD1D blocking peptide

CD1D Peptide - C-terminal region

Gene Names
CD1D; R3; CD1A; R3G1
Reactivity
Human
Applications
Western Blot
Synonyms
CD1D; CD1D Peptide - C-terminal region; CD1D blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
Sequence Length
335
Applicable Applications for CD1D blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD1D blocking peptide
This is a synthetic peptide designed for use in combination with anti-CD1D Antibody, made

Target Description: This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail.
Product Categories/Family for CD1D blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
912
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
antigen-presenting glycoprotein CD1d isoform 1
NCBI Official Synonym Full Names
CD1d molecule
NCBI Official Symbol
CD1D
NCBI Official Synonym Symbols
R3; CD1A; R3G1
NCBI Protein Information
antigen-presenting glycoprotein CD1d
UniProt Protein Name
Antigen-presenting glycoprotein CD1d
UniProt Gene Name
CD1D
UniProt Entry Name
CD1D_HUMAN

NCBI Description

This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

CD1D: Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.

Protein type: Apoptosis; Membrane protein, integral; Lipid-binding; Cell surface

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: cell surface; lysosomal membrane; integral to plasma membrane; cytoplasm; endosome membrane

Molecular Function: histone binding; beta-2-microglobulin binding; exogenous lipid antigen binding; lipid antigen binding; cell adhesion molecule binding; receptor activity; endogenous lipid antigen binding

Biological Process: antigen processing and presentation, endogenous lipid antigen via MHC class Ib; heterotypic cell-cell adhesion; detection of bacterium; viral reproduction; positive regulation of innate immune response; antigen processing and presentation, exogenous lipid antigen via MHC class Ib; T cell selection; innate immune response; positive regulation of T cell proliferation

Research Articles on CD1D

Similar Products

Product Notes

The CD1D cd1d (Catalog #AAA3240782) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD1D Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD1D cd1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LEGQDIVLYW GGSYTSMGLI ALAVLACLLF LLIVGFTSRF KRQTSYQGVL. It is sometimes possible for the material contained within the vial of "CD1D, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.