Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

OGG1 blocking peptide

OGG1 Peptide - C-terminal region

Gene Names
OGG1; HMMH; MUTM; OGH1; HOGG1
Reactivity
Human
Applications
Western Blot
Synonyms
OGG1; OGG1 Peptide - C-terminal region; OGG1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
AVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGW
Sequence Length
322
Applicable Applications for OGG1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for OGG1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-OGG1 Antibody, made

Target Description: This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization.
Product Categories/Family for OGG1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
N-glycosylase/DNA lyase isoform 2e
NCBI Official Synonym Full Names
8-oxoguanine DNA glycosylase
NCBI Official Symbol
OGG1
NCBI Official Synonym Symbols
HMMH; MUTM; OGH1; HOGG1
NCBI Protein Information
N-glycosylase/DNA lyase
UniProt Protein Name
N-glycosylase/DNA lyase
Protein Family
UniProt Gene Name
OGG1
UniProt Synonym Gene Names
MMH; MUTM; OGH1; AP lyase
UniProt Entry Name
OGG1_HUMAN

NCBI Description

This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined. [provided by RefSeq, Aug 2008]

Uniprot Description

OGG1: DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N- methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta- lyase activity that nicks DNA 3' to the lesion. Defects in OGG1 may be a cause of renal cell carcinoma (RCC). It is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma. Belongs to the type-1 OGG1 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Lyase; Deoxyribonuclease; EC 4.2.99.18; DNA repair, damage

Chromosomal Location of Human Ortholog: 3p26.2

Cellular Component: nucleoplasm; nuclear matrix; mitochondrion; nuclear speck

Molecular Function: protein binding; endonuclease activity; microtubule binding; oxidized purine base lesion DNA N-glycosylase activity; DNA N-glycosylase activity; damaged DNA binding; 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity

Biological Process: response to drug; depurination; DNA repair; DNA catabolic process, endonucleolytic; response to estradiol stimulus; response to radiation; response to ethanol; base-excision repair, AP site formation; regulation of transcription, DNA-dependent; base-excision repair; nucleotide-excision repair; response to folic acid; regulation of protein import into nucleus, translocation; response to oxidative stress; acute inflammatory response; negative regulation of apoptosis; aging

Disease: Renal Cell Carcinoma, Nonpapillary

Research Articles on OGG1

Similar Products

Product Notes

The OGG1 ogg1 (Catalog #AAA3240051) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The OGG1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OGG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OGG1 ogg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AVPVDVHMWH IAQRDYSWHP TTSQAKGPSP QTNKELGNFF RSLWGPYAGW. It is sometimes possible for the material contained within the vial of "OGG1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.