Atp1a1 blocking peptide
Atp1a1 Peptide - middle region
Gene Names
Atp1a1; Nkaa1b
Reactivity
Rat, Human
Applications
Western Blot
Synonyms
Atp1a1; Atp1a1 Peptide - middle region; Atp1a1 blocking peptide
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Sequence
KHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGER
Sequence Length
1023
Applicable Applications for Atp1a1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Atp1a1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Atp1a1 Antibody, made
Target Description: Atp1a1 mediates Na+ and K+ transport; It may play a role in regulation of blood pressure.
Target Description: Atp1a1 mediates Na+ and K+ transport; It may play a role in regulation of blood pressure.
Product Categories/Family for Atp1a1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit alpha-1
NCBI Official Synonym Full Names
ATPase Na+/K+ transporting subunit alpha 1
NCBI Official Symbol
Atp1a1
NCBI Official Synonym Symbols
Nkaa1b
NCBI Protein Information
sodium/potassium-transporting ATPase subunit alpha-1
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit alpha-1
Protein Family
UniProt Gene Name
Atp1a1
UniProt Synonym Gene Names
Na(+)/K(+) ATPase alpha-1 subunit
NCBI Description
mediates Na+ and K+ transport; may play a role in regulation of blood pressure [RGD, Feb 2006]
Uniprot Description
This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.
Research Articles on Atp1a1
Similar Products
Product Notes
The Atp1a1 atp1a1 (Catalog #AAA3239638) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Atp1a1 Peptide - middle region reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Atp1a1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Atp1a1 atp1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KHLLVMKGAP ERILDRCSSI LLHGKEQPLD EELKDAFQNA YLELGGLGER. It is sometimes possible for the material contained within the vial of "Atp1a1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
