Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

F2R blocking peptide

F2R Peptide - C-terminal region

Gene Names
F2R; TR; HTR; CF2R; PAR1; PAR-1
Reactivity
Human
Synonyms
F2R; F2R Peptide - C-terminal region; F2R blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIYKKL
Sequence Length
425
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for F2R blocking peptide
Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants.
Product Categories/Family for F2R blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
proteinase-activated receptor 1 isoform 1
NCBI Official Synonym Full Names
coagulation factor II thrombin receptor
NCBI Official Symbol
F2R
NCBI Official Synonym Symbols
TR; HTR; CF2R; PAR1; PAR-1
NCBI Protein Information
proteinase-activated receptor 1
UniProt Protein Name
Proteinase-activated receptor 1
UniProt Gene Name
F2R
UniProt Synonym Gene Names
CF2R; PAR1; TR; PAR-1
UniProt Entry Name
PAR1_HUMAN

NCBI Description

Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]

Uniprot Description

PAR1: a G-protein coupled high-affinity receptor for activated thrombin or trypsin. Coupled to G proteins that stimulate phosphoinositide hydrolysis. Coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelet activation and in vascular development.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Cell development/differentiation

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: Golgi apparatus; postsynaptic membrane; integral to plasma membrane; early endosome; extracellular region; plasma membrane; caveola; neuromuscular junction

Molecular Function: G-protein coupled receptor activity; protein binding; G-protein alpha-subunit binding; G-protein beta-subunit binding; receptor binding; thrombin receptor activity

Biological Process: elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of blood coagulation; negative regulation of glomerular filtration; activation of MAPKK activity; positive regulation of transcription, DNA-dependent; positive regulation of collagen biosynthetic process; positive regulation of caspase activity; positive regulation of JAK-STAT cascade; response to lipopolysaccharide; negative regulation of cell proliferation; connective tissue replacement during inflammatory response; elevation of cytosolic calcium ion concentration; platelet dense granule organization and biogenesis; positive regulation of MAPKKK cascade; regulation of interleukin-1 beta production; protein kinase C activation; positive regulation of cell proliferation; response to wounding; negative regulation of neuron apoptosis; positive regulation of smooth muscle contraction; establishment of synaptic specificity at neuromuscular junction; inflammatory response; STAT protein nuclear translocation; caspase activation; platelet activation; anatomical structure morphogenesis; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of Rho protein signal transduction; positive regulation of phosphoinositide 3-kinase cascade; tyrosine phosphorylation of STAT protein; G-protein coupled receptor protein signaling pathway; homeostasis of number of cells within a tissue; release of sequestered calcium ion into cytosol; regulation of blood coagulation; positive regulation of vasoconstriction; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of release of sequestered calcium ion into cytosol; regulation of sensory perception of pain; positive regulation of calcium ion transport; blood coagulation; positive regulation of cell migration

Research Articles on F2R

Similar Products

Product Notes

The F2R f2r (Catalog #AAA3239565) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The F2R Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASSECQRYVY SILCCKESSD PSSYNSSGQL MASKMDTCSS NLNNSIYKKL. It is sometimes possible for the material contained within the vial of "F2R, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.