Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IGSF8 blocking peptide

IGSF8 Peptide - middle region

Gene Names
IGSF8; EWI2; PGRL; CD316; EWI-2; KCT-4; CD81P3; LIR-D1
Reactivity
Human
Applications
Western Blot
Synonyms
IGSF8; IGSF8 Peptide - middle region; IGSF8 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW
Sequence Length
613
Applicable Applications for IGSF8 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IGSF8 blocking peptide
This is a synthetic peptide designed for use in combination with anti-IGSF8 Antibody, made

Target Description: IGSF8 may play a key role in diverse functions ascribed to CD81 and CD9 such as oocytes fertilization or hepatitis C virus function. IGSF8 may regulate proliferation and differentiation of keratinocytes. IGSF8 may be a negative regulator of cell motility: suppresses T-cell mobility coordinately with CD81, associates with CD82 to suppress prostate cancer cell migration, regulates epidermoid cell reaggregation and motility on laminin-5 with CD9 and CD81 as key linkers. IGSF8 may also play a role on integrin-dependent morphology and motility functions. IGSF8 may participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain.
Product Categories/Family for IGSF8 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
immunoglobulin superfamily member 8
NCBI Official Synonym Full Names
immunoglobulin superfamily member 8
NCBI Official Symbol
IGSF8
NCBI Official Synonym Symbols
EWI2; PGRL; CD316; EWI-2; KCT-4; CD81P3; LIR-D1
NCBI Protein Information
immunoglobulin superfamily member 8
UniProt Protein Name
Immunoglobulin superfamily member 8
UniProt Gene Name
IGSF8
UniProt Synonym Gene Names
CD81P3; EWI2; KCT4; IgSF8; EWI-2; KCT-4; PGRL

NCBI Description

This gene encodes a member the EWI subfamily of the immunoglobulin protein superfamily. Members of this family contain a single transmembrane domain, an EWI (Glu-Trp-Ile)-motif and a variable number of immunoglobulin domains. This protein interacts with the tetraspanins CD81 and CD9 and may regulate their role in certain cellular functions including cell migration and viral infection. The encoded protein may also function as a tumor suppressor by inhibiting the proliferation of certain cancers. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]

Uniprot Description

May play a key role in diverse functions ascribed to CD81 and CD9 such as oocytes fertilization or hepatitis C virus function. May regulate proliferation and differentiation of keratinocytes. May be a negative regulator of cell motility: suppresses T-cell mobility coordinately with CD81, associates with CD82 to suppress prostate cancer cell migration, regulates epidermoid cell reaggregation and motility on laminin-5 with CD9 and CD81 as key linkers. May also play a role on integrin-dependent morphology and motility functions. May participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain.

Research Articles on IGSF8

Similar Products

Product Notes

The IGSF8 igsf8 (Catalog #AAA3239487) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IGSF8 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IGSF8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IGSF8 igsf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAVEAGAPYA ERLAAGELRL GKEGTDRYRM VVGGAQAGDA GTYHCTAAEW. It is sometimes possible for the material contained within the vial of "IGSF8, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.