Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TLR2 blocking peptide

TLR2 Peptide - N-terminal region

Gene Names
TLR2; TIL4; CD282
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Synonyms
TLR2; TLR2 Peptide - N-terminal region; TLR2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
EIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLEL
Sequence Length
784
Applicable Applications for TLR2 blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TLR2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TLR2 Antibody, made

Target Description: TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB.
Product Categories/Family for TLR2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
toll-like receptor 2
NCBI Official Synonym Full Names
toll like receptor 2
NCBI Official Symbol
TLR2
NCBI Official Synonym Symbols
TIL4; CD282
NCBI Protein Information
toll-like receptor 2
UniProt Protein Name
Toll-like receptor 2
Protein Family
UniProt Gene Name
TLR2
UniProt Synonym Gene Names
TIL4
UniProt Entry Name
TLR2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. This protein is a cell-surface protein that can form heterodimers with other TLR family members to recognize conserved molecules derived from microorganisms known as pathogen-associated molecular patterns (PAMPs). Activation of TLRs by PAMPs leads to an up-regulation of signaling pathways to modulate the host's inflammatory response. This gene is also thought to promote apoptosis in response to bacterial lipoproteins. This gene has been implicated in the pathogenesis of several autoimmune diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

TLR2: Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmal macrophage- activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6. Interacts with LY96, TLR1 and TLR6 (via extracellular domain). Binds MYD88 (via TIR domain). Interacts with TICAM1. Ligand binding induces the formation of a heterodimer with TLR1. Interacts with CNPY3. Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues. Belongs to the Toll-like receptor family.

Protein type: Apoptosis; Motility/polarity/chemotaxis; Cell surface; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q32

Cellular Component: cell surface; cell projection; integral to plasma membrane; cytoplasm; plasma membrane; external side of plasma membrane

Molecular Function: peptidoglycan binding; protein binding; transmembrane receptor activity; protein heterodimerization activity; triacylated lipoprotein binding; lipopolysaccharide receptor activity; receptor activity; pattern recognition receptor activity; diacylated lipoprotein binding

Biological Process: positive regulation of nitric oxide biosynthetic process; response to toxin; positive regulation of leukocyte migration; leukotriene metabolic process; positive regulation of NF-kappaB import into nucleus; detection of triacylated bacterial lipoprotein; positive regulation of interleukin-10 production; activation of NF-kappaB transcription factor; positive regulation of interferon-beta production; positive regulation of oligodendrocyte differentiation; toll-like receptor 4 signaling pathway; negative regulation of interleukin-12 production; detection of diacylated bacterial lipoprotein; cell surface pattern recognition receptor signaling pathway; positive regulation of interleukin-6 production; positive regulation of tumor necrosis factor production; positive regulation of chemokine production; toll-like receptor 2 signaling pathway; defense response to Gram-positive bacterium; myelin formation in the central nervous system; positive regulation of transcription from RNA polymerase II promoter; response to progesterone stimulus; I-kappaB phosphorylation; positive regulation of nitric-oxide synthase biosynthetic process; apoptosis; positive regulation of interleukin-12 production; microglial cell activation; response to molecule of fungal origin; positive regulation of interleukin-18 production; signal transduction; nitric oxide metabolic process; response to insulin stimulus; positive regulation of interleukin-8 production; negative regulation of cell proliferation; lipopolysaccharide-mediated signaling pathway; inflammatory response; positive regulation of Wnt receptor signaling pathway; positive regulation of tumor necrosis factor biosynthetic process; positive regulation of toll-like receptor signaling pathway; induction by symbiont of defense-related host nitric oxide production; MyD88-dependent toll-like receptor signaling pathway; negative regulation of interleukin-17 production; response to hypoxia; toll-like receptor signaling pathway; innate immune response; immune response; chloramphenicol transport; positive regulation of cytokine secretion; positive regulation of inflammatory response

Disease: Leprosy, Susceptibility To, 3; Mycobacterium Tuberculosis, Susceptibility To

Research Articles on TLR2

Similar Products

Product Notes

The TLR2 tlr2 (Catalog #AAA3239100) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TLR2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TLR2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TLR2 tlr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EIDASDLQSY EPKSLKSIQN VSHLILHMKQ HILLLEIFVD VTSSVECLEL. It is sometimes possible for the material contained within the vial of "TLR2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.