Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CASP4 blocking peptide

CASP4 Peptide - middle region

Gene Names
CASP4; TX; Mih1; ICH-2; Mih1/TX; ICEREL-II; ICE(rel)II
Reactivity
Human
Applications
Western Blot
Synonyms
CASP4; CASP4 Peptide - middle region; CASP4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRG
Sequence Length
377
Applicable Applications for CASP4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CASP4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CASP4 Antibody, made

Target Description: This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.
Product Categories/Family for CASP4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
837
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
caspase-4 isoform alpha
NCBI Official Synonym Full Names
caspase 4
NCBI Official Symbol
CASP4
NCBI Official Synonym Symbols
TX; Mih1; ICH-2; Mih1/TX; ICEREL-II; ICE(rel)II
NCBI Protein Information
caspase-4
UniProt Protein Name
Caspase-4
Protein Family
UniProt Gene Name
CASP4
UniProt Synonym Gene Names
ICH2; CASP-4
UniProt Entry Name
CASP4_HUMAN

NCBI Description

This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CASP4: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves caspase-1. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a small and a large subunit. Widely expressed, with highest levels in spleen and lung. Moderate expression in heart and liver, low expression in skeletal muscle, kidney and testis. Not found in the brain. Belongs to the peptidase C14A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Protease; EC 3.4.22.64

Chromosomal Location of Human Ortholog: 11q22.2-q22.3

Cellular Component: endoplasmic reticulum membrane; mitochondrion; cytoplasm

Molecular Function: cysteine-type endopeptidase activity

Biological Process: regulation of apoptosis; apoptosis; regulation of inflammatory response; proteolysis

Research Articles on CASP4

Similar Products

Product Notes

The CASP4 casp4 (Catalog #AAA3239082) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CASP4 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP4 casp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GILEGICGTV HDEKKPDVLL YDTIFQIFNN RNCLSLKDKP KVIIVQACRG. It is sometimes possible for the material contained within the vial of "CASP4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.