Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CASP4Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CASP4 Polyclonal Antibody | anti-CASP4 antibody

CASP4 Antibody - N-terminal region

Gene Names
CASP4; TX; Mih1; ICH-2; Mih1/TX; ICEREL-II; ICE(rel)II
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CASP4; Polyclonal Antibody; CASP4 Antibody - N-terminal region; anti-CASP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVM
Sequence Length
116
Applicable Applications for anti-CASP4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CASP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CASP4Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CASP4Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CASP4 antibody
This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.
Product Categories/Family for anti-CASP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
837
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13 kDa
NCBI Official Full Name
caspase-4 isoform alpha
NCBI Official Synonym Full Names
caspase 4
NCBI Official Symbol
CASP4
NCBI Official Synonym Symbols
TX; Mih1; ICH-2; Mih1/TX; ICEREL-II; ICE(rel)II
NCBI Protein Information
caspase-4
UniProt Protein Name
Caspase-4
Protein Family
UniProt Gene Name
CASP4
UniProt Synonym Gene Names
ICH2; CASP-4
UniProt Entry Name
CASP4_HUMAN

NCBI Description

This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CASP4: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves caspase-1. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a small and a large subunit. Widely expressed, with highest levels in spleen and lung. Moderate expression in heart and liver, low expression in skeletal muscle, kidney and testis. Not found in the brain. Belongs to the peptidase C14A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Protease; EC 3.4.22.64

Chromosomal Location of Human Ortholog: 11q22.2-q22.3

Cellular Component: endoplasmic reticulum membrane; mitochondrion; cytoplasm

Molecular Function: cysteine-type endopeptidase activity

Biological Process: regulation of apoptosis; apoptosis; regulation of inflammatory response; proteolysis

Research Articles on CASP4

Similar Products

Product Notes

The CASP4 casp4 (Catalog #AAA3222375) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP4 casp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKPLKVLESL GKDFLTGVLD NLVEQNVLNW KEEEKKKYYD AKTEDKVRVM. It is sometimes possible for the material contained within the vial of "CASP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.