ATPAF1 blocking peptide
ATPAF1 Peptide - middle region
Gene Names
ATPAF1; ATP11; ATP11p
Reactivity
Human
Applications
Western Blot
Synonyms
ATPAF1; ATPAF1 Peptide - middle region; ATPAF1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK
Sequence Length
328
Applicable Applications for ATPAF1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATPAF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATPAF1 Antibody, made
Target Description: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
Target Description: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
Product Categories/Family for ATPAF1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
ATP synthase mitochondrial F1 complex assembly factor 1 isoform 1
NCBI Official Synonym Full Names
ATP synthase mitochondrial F1 complex assembly factor 1
NCBI Official Symbol
ATPAF1
NCBI Official Synonym Symbols
ATP11; ATP11p
NCBI Protein Information
ATP synthase mitochondrial F1 complex assembly factor 1
UniProt Protein Name
ATP synthase mitochondrial F1 complex assembly factor 1
Protein Family
UniProt Gene Name
ATPAF1
UniProt Synonym Gene Names
ATP11
UniProt Entry Name
ATPF1_HUMAN
NCBI Description
This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011]
Research Articles on ATPAF1
Similar Products
Product Notes
The ATPAF1 atpaf1 (Catalog #AAA3238424) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATPAF1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATPAF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATPAF1 atpaf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KQPVGHSRQG DFIKCVEQKT DALGKQSVNR GFTKDKTLSS IFNIEMVKEK. It is sometimes possible for the material contained within the vial of "ATPAF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
