WDR5B blocking peptide
WDR5B Peptide - N-terminal region
Reactivity
Human
Applications
Western Blot
Synonyms
WDR5B; WDR5B Peptide - N-terminal region; WDR5B blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPS
Sequence Length
330
Applicable Applications for WDR5B blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for WDR5B blocking peptide
This is a synthetic peptide designed for use in combination with anti-WDR5B Antibody, made
Target Description: This intronless gene encodes a protein containing several WD40 repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, including a trp-asp at the C-terminal end. The encoded protein may mediate protein-protein interactions.
Target Description: This intronless gene encodes a protein containing several WD40 repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, including a trp-asp at the C-terminal end. The encoded protein may mediate protein-protein interactions.
Product Categories/Family for WDR5B blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
WD repeat-containing protein 5B
NCBI Official Synonym Full Names
WD repeat domain 5B
NCBI Official Symbol
WDR5B
NCBI Protein Information
WD repeat-containing protein 5B
UniProt Protein Name
WD repeat-containing protein 5B
Protein Family
UniProt Gene Name
WDR5B
UniProt Entry Name
WDR5B_HUMAN
NCBI Description
This intronless gene encodes a protein containing several WD40 repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, including a trp-asp at the C-terminal end. The encoded protein may mediate protein-protein interactions. [provided by RefSeq, Jul 2008]
Uniprot Description
Function: May function as a substrate receptor for CUL4-DDB1 ubiquitin E3 ligase complex
By similarity.
Subunit structure: Probable part of a cullin-RING E3 protein ligase complex containing CUL4B-DDB1 and a substrate-recruiting component (DCAF). Interacts with CUL4B and DDB1
By similarity.
Sequence similarities: Belongs to the WD repeat WDR5/wds family.Contains 7 WD repeats.
Similar Products
Product Notes
The WDR5B wdr5b (Catalog #AAA3238246) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The WDR5B Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR5B wdr5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVAWSSDSSR LVSASDDKTL KLWDVRSGKC LKTLKGHSNY VFCCNFNPPS. It is sometimes possible for the material contained within the vial of "WDR5B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
