Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RALBP1 blocking peptide

RALBP1 Peptide - N-terminal region

Gene Names
RALBP1; RIP1; RLIP1; RLIP76
Reactivity
Human
Applications
Western Blot
Synonyms
RALBP1; RALBP1 Peptide - N-terminal region; RALBP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPP
Sequence Length
655
Applicable Applications for RALBP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RALBP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-RALBP1 Antibody, made

Target Description: RALBP1 can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. RALBP1 mediates ATP-dependent transport of S-(2,4-dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes.RALBP1 can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. RALBP1 serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin.
Product Categories/Family for RALBP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
ralA-binding protein 1
NCBI Official Synonym Full Names
ralA binding protein 1
NCBI Official Symbol
RALBP1
NCBI Official Synonym Symbols
RIP1; RLIP1; RLIP76
NCBI Protein Information
ralA-binding protein 1
UniProt Protein Name
RalA-binding protein 1
Protein Family
UniProt Gene Name
RALBP1
UniProt Synonym Gene Names
RLIP1; RLIP76; RalBP1; DNP-SG ATPase
UniProt Entry Name
RBP1_HUMAN

NCBI Description

RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RAL (see RALA; MIM 179550). Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive to the active state through the action of RALGDS (MIM 601619), which in turn is activated by RAS (see HRAS; MIM 190020) (summary by Feig, 2003 [PubMed 12888294]).[supplied by OMIM, Nov 2010]

Uniprot Description

RALBP1: Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4-dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes. Can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin. Interacts with the GTP-bound form of RALA, RALB, CDC42 and RAC1. Interacts with REPS1 and REPS2 and this does not affect the Ral-binding activity. Interacts with DAB2IP. Interacts with catalytically active CCNB1 and CDK1 during mitosis. Interacts with EPN1, NUMB and TFAP2A during interphase and mitosis. Expressed ubiquitously but at low levels. Shows a strong expression in the erythrocytes.

Protein type: GAPs; GAPs, Rac/Rho

Chromosomal Location of Human Ortholog: 18p11.3

Cellular Component: membrane; cytosol

Molecular Function: protein binding; ATPase activity, coupled to movement of substances; ATPase activity; Rac GTPase binding; Ral GTPase binding; GTPase activator activity

Biological Process: regulation of GTPase activity; regulation of small GTPase mediated signal transduction; metabolic process; transport; small GTPase mediated signal transduction; chemotaxis; signal transduction

Research Articles on RALBP1

Similar Products

Product Notes

The RALBP1 ralbp1 (Catalog #AAA3235643) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RALBP1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RALBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RALBP1 ralbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTECFLPPTS SPSEHRRVEH GSGLTRTPSS EEISPTKFPG LYRTGEPSPP. It is sometimes possible for the material contained within the vial of "RALBP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.