Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EME2 blocking peptide

EME2 Peptide - middle region

Gene Names
EME2; SLX2B; gs125
Reactivity
Human
Applications
Western Blot
Synonyms
EME2; EME2 Peptide - middle region; EME2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR
Sequence Length
379
Applicable Applications for EME2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EME2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-EME2 Antibody, made

Target Description: EME2 forms a heterodimer with MUS81 that functions as an XPF-type flap/fork endonuclease in DNA repair .
Product Categories/Family for EME2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
probable crossover junction endonuclease EME2
NCBI Official Synonym Full Names
essential meiotic structure-specific endonuclease subunit 2
NCBI Official Symbol
EME2
NCBI Official Synonym Symbols
SLX2B; gs125
NCBI Protein Information
probable crossover junction endonuclease EME2
UniProt Protein Name
Probable crossover junction endonuclease EME2
UniProt Gene Name
EME2

NCBI Description

EME2 forms a heterodimer with MUS81 (MIM 606591) that functions as an XPF (MIM 278760)-type flap/fork endonuclease in DNA repair (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIM, Mar 2008]

Uniprot Description

EME2: Interacts with MUS81 to form a DNA structure-specific endonuclease which cleaves substrates such as 3'-flap structures. Belongs to the EME1/MMS4 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Deoxyribonuclease; EC 3.1.22.-

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nuclear chromatin

Molecular Function: crossover junction endodeoxyribonuclease activity; DNA binding

Biological Process: double-strand break repair; intra-S DNA damage checkpoint; replication fork processing; resolution of meiotic recombination intermediates

Research Articles on EME2

Similar Products

Product Notes

The EME2 eme2 (Catalog #AAA3235298) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EME2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EME2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EME2 eme2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTARPHLAVI GLDAYLWSRQ HVSRGTQQPE SPKVAGAEVA VSWPEVEEVR. It is sometimes possible for the material contained within the vial of "EME2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.