Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC6A3 blocking peptide

SLC6A3 Peptide - N-terminal region

Gene Names
SLC6A3; DAT; DAT1; PKDYS; PKDYS1
Reactivity
Human
Applications
Western Blot
Synonyms
SLC6A3; SLC6A3 Peptide - N-terminal region; SLC6A3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH
Sequence Length
620
Applicable Applications for SLC6A3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC6A3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC6A3 Antibody, made

Target Description: This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
Product Categories/Family for SLC6A3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
sodium-dependent dopamine transporter
NCBI Official Synonym Full Names
solute carrier family 6 member 3
NCBI Official Symbol
SLC6A3
NCBI Official Synonym Symbols
DAT; DAT1; PKDYS; PKDYS1
NCBI Protein Information
sodium-dependent dopamine transporter
UniProt Protein Name
Sodium-dependent dopamine transporter
UniProt Gene Name
SLC6A3
UniProt Synonym Gene Names
DAT1; DA transporter; DAT
UniProt Entry Name
SC6A3_HUMAN

NCBI Description

This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.[provided by RefSeq, Nov 2009]

Uniprot Description

DAT: Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals. Defects in SLC6A3 are the cause of dystonia-parkinsonism infantile (DYTPRI). It is a neurodegenerative disorder characterized by infantile onset of parkinsonism and dystonia. Other neurologic features include global developmental delay, bradikinesia and pyramidal tract signs. Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A3 subfamily.

Protein type: Transporter, SLC family; Transporter; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5p15.3

Cellular Component: cell soma; axon; integral to plasma membrane; cytoplasm; integral to membrane; plasma membrane

Molecular Function: protein binding; protease binding; dopamine binding; monoamine transmembrane transporter activity; protein complex binding; protein N-terminus binding; dopamine:sodium symporter activity; drug binding; dopamine transmembrane transporter activity; receptor binding

Biological Process: lactation; response to drug; response to nicotine; dopamine transport; response to cAMP; prepulse inhibition; dopamine catabolic process; regulation of dopamine metabolic process; monoamine transport; sensory perception of smell; locomotory behavior; dopamine biosynthetic process; positive regulation of multicellular organism growth; response to cocaine; synaptic transmission; response to ethanol; neurotransmitter transport; adenohypophysis development; response to iron ion; transmembrane transport; aging; neurotransmitter biosynthetic process

Disease: Parkinsonism-dystonia, Infantile; Tobacco Addiction, Susceptibility To

Research Articles on SLC6A3

Similar Products

Product Notes

The SLC6A3 slc6a3 (Catalog #AAA3231999) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC6A3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC6A3 slc6a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HCNNSWNSPN CSDAHPGDSS GDSSGLNDTF GTTPAAEYFE RGVLHLHQSH. It is sometimes possible for the material contained within the vial of "SLC6A3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.