Mafa blocking peptide
Mafa Peptide - middle region
Gene Names
Mafa; RIPE3b1
Reactivity
Mouse
Applications
Western Blot
Synonyms
Mafa; Mafa Peptide - middle region; Mafa blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
GGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALN
Sequence Length
359
Applicable Applications for Mafa blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Mafa blocking peptide
This is a synthetic peptide designed for use in combination with anti-Mafa Antibody, made
Target Description: Mafa acts as a transcriptional factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context.
Target Description: Mafa acts as a transcriptional factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context.
Product Categories/Family for Mafa blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
transcription factor MafA
NCBI Official Synonym Full Names
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian)
NCBI Official Symbol
Mafa
NCBI Official Synonym Symbols
RIPE3b1
NCBI Protein Information
transcription factor MafA
UniProt Protein Name
Transcription factor MafA
Protein Family
UniProt Gene Name
Mafa
UniProt Entry Name
MAFA_MOUSE
Research Articles on Mafa
Similar Products
Product Notes
The Mafa mafa (Catalog #AAA3228641) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Mafa Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Mafa can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Mafa mafa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGGSAAQAGG APGPPSGGPG TVGGASGKAV LEDLYWMSGY QHHLNPEALN. It is sometimes possible for the material contained within the vial of "Mafa, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
