Rb1 blocking peptide
Rb1 Peptide - middle region
Gene Names
Rb1; Rb; pRb; Rb-1; pp105
Reactivity
MOUSE, Human
Applications
Western Blot
Synonyms
Rb1; Rb1 Peptide - middle region; Rb1 blocking peptide
Reactivity
MOUSE, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE
Sequence Length
921
Applicable Applications for Rb1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Rb1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Rb1 Antibody, made
Target Description: SLC11A1 is key regulator of entry into cell division that acts as a tumor suppressor. It promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. It acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. It recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. It controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. It mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex By similarity.
Target Description: SLC11A1 is key regulator of entry into cell division that acts as a tumor suppressor. It promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. It acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. It recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. It controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. It mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex By similarity.
Product Categories/Family for Rb1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
retinoblastoma-associated protein
NCBI Official Synonym Full Names
RB transcriptional corepressor 1
NCBI Official Symbol
Rb1
NCBI Official Synonym Symbols
Rb; pRb; Rb-1; pp105
NCBI Protein Information
retinoblastoma-associated protein
UniProt Protein Name
Retinoblastoma-associated protein
Protein Family
UniProt Gene Name
Rb1
UniProt Synonym Gene Names
Rb-1; Rb
UniProt Entry Name
RB_MOUSE
Research Articles on Rb1
Similar Products
Product Notes
The Rb1 rb1 (Catalog #AAA3226409) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Rb1 Peptide - middle region reacts with MOUSE, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Rb1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Rb1 rb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TETQAASAFH TQKPLKSTSL ALFYKKVYRL AYLRLNTLCA RLLSDHPELE. It is sometimes possible for the material contained within the vial of "Rb1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
