Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney)

Rabbit TRAP1 Polyclonal Antibody | anti-TRAP1 antibody

TRAP1 antibody - N-terminal region

Gene Names
TRAP1; HSP75; HSP 75; HSP90L; TRAP-1
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
TRAP1; Polyclonal Antibody; TRAP1 antibody - N-terminal region; anti-TRAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEF
Sequence Length
704
Applicable Applications for anti-TRAP1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 85%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney)

Immunohistochemistry (IHC) (Human kidney)
Related Product Information for anti-TRAP1 antibody
This is a rabbit polyclonal antibody against TRAP1. It was validated on Western Blot and immunohistochemistry

Target Description: Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
Product Categories/Family for anti-TRAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
heat shock protein 75 kDa, mitochondrial isoform 1
NCBI Official Synonym Full Names
TNF receptor associated protein 1
NCBI Official Symbol
TRAP1
NCBI Official Synonym Symbols
HSP75; HSP 75; HSP90L; TRAP-1
NCBI Protein Information
heat shock protein 75 kDa, mitochondrial
UniProt Protein Name
Heat shock protein 75 kDa, mitochondrial
UniProt Gene Name
TRAP1
UniProt Synonym Gene Names
HSP75; HSP 75; TRAP-1
UniProt Entry Name
TRAP1_HUMAN

NCBI Description

This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stress responses. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

HSP75: Chaperone that expresses an ATPase activity. Belongs to the heat shock protein 90 family.

Protein type: Chaperone; Heat shock protein

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; membrane; mitochondrion; mitochondrial matrix; mitochondrial inner membrane; mitochondrial intermembrane space; lipid particle

Molecular Function: protein binding; unfolded protein binding; protein kinase binding; tumor necrosis factor receptor binding; ATP binding

Biological Process: response to stress

Research Articles on TRAP1

Similar Products

Product Notes

The TRAP1 trap1 (Catalog #AAA3224312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAP1 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRAP1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRAP1 trap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQLGPRRNPA WSLQAGRLFS TQTAEDKEEP LHSIISSTES VQGSTSKHEF. It is sometimes possible for the material contained within the vial of "TRAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.